(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE75

MICSR_1.PE75         Location/Qualifiers
FT   CDS             complement(143046..144416)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636080"
FT                   /orf_name="MICPUN_56648"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="nucleotide binding"
FT                   /protein_id="ACO62067.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199ACA3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V2"
FT                   /transl_table=1
FT                   /translation="MDFDITTARPAGPRPAAPVAAPQQPGGTQAGSAHHHPPGAGGAST
FT                   SPPVAPDDVPASIFITGVSPAVNDGTLREFLECCGPLRSLAQFGDVPLPGQPRQYVATY
FT                   ADVAAAQSSLVLNNMTLVDRPITVVAAERAVGPGGVLDLSKGGSSAVPSGADLLNPLAS
FT                   MEQAVMTGLVEDPLKLWRQAAEKLPSWFPAGYKRCALFVPIPHLINGAMAAAEARIEFE
FT                   KEVRDTAGGHVDDSDVSRTVYAGNVNSSITEDMLADFFSIAGNVTYVKFAGSEFNPSRF
FT                   GFVEFDTKAAAESAKALTGTQVAEMTIKVKHSNNPIVKDRMRNFWGTCRTERRRRMRRE
FT                   RKRFKEKERERLRGGESSSSESESESSSSSSEERRRRRRRRREREERDEKREKKSRDKD
FT                   ADEGGDEKERKSSREKKEDAREKKSDEEEDEKKLREEARRSRKSRRKSEGEGKEDAA"
     MDFDITTARP AGPRPAAPVA APQQPGGTQA GSAHHHPPGA GGASTSPPVA PDDVPASIFI        60
     TGVSPAVNDG TLREFLECCG PLRSLAQFGD VPLPGQPRQY VATYADVAAA QSSLVLNNMT       120
     LVDRPITVVA AERAVGPGGV LDLSKGGSSA VPSGADLLNP LASMEQAVMT GLVEDPLKLW       180
     RQAAEKLPSW FPAGYKRCAL FVPIPHLING AMAAAEARIE FEKEVRDTAG GHVDDSDVSR       240
     TVYAGNVNSS ITEDMLADFF SIAGNVTYVK FAGSEFNPSR FGFVEFDTKA AAESAKALTG       300
     TQVAEMTIKV KHSNNPIVKD RMRNFWGTCR TERRRRMRRE RKRFKEKERE RLRGGESSSS       360
     ESESESSSSS SEERRRRRRR RREREERDEK REKKSRDKDA DEGGDEKERK SSREKKEDAR       420
     EKKSDEEEDE KKLREEARRS RKSRRKSEGE GKEDAA                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page