(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE76

MICSR_1.PE76         Location/Qualifiers
FT   CDS             144592..145497
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636081"
FT                   /orf_name="MICPUN_56649"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61621.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ACA4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V3"
FT                   /transl_table=1
FT                   /translation="MTTGRRPNVRIDIEDVVADAEVADEVNDASLTKKGTKRKRAPPTK
FT                   GPCEHGLKYRSRCKVCSACPHGKWRKRCKECGGSQICEHSRQRSKCKECGGASICEHSR
FT                   QRSTCKKCGGSQICVHGRRRSTCKECGGSAICEHGRQRSTCKECGGSAICEHGRIRFSC
FT                   KECGGGSICEHGRRHSRCKDCGGASICVHGRVRYQCKECGGSAICEHGRIRFSCKECGG
FT                   SAICEHGRVRYQCKECGGSGICQHGRQRSTCKECGGSQVCEHGRRRSECKKCGGSSICE
FT                   HGRQLHRCKECGADEGTRRR"
     MTTGRRPNVR IDIEDVVADA EVADEVNDAS LTKKGTKRKR APPTKGPCEH GLKYRSRCKV        60
     CSACPHGKWR KRCKECGGSQ ICEHSRQRSK CKECGGASIC EHSRQRSTCK KCGGSQICVH       120
     GRRRSTCKEC GGSAICEHGR QRSTCKECGG SAICEHGRIR FSCKECGGGS ICEHGRRHSR       180
     CKDCGGASIC VHGRVRYQCK ECGGSAICEH GRIRFSCKEC GGSAICEHGR VRYQCKECGG       240
     SGICQHGRQR STCKECGGSQ VCEHGRRRSE CKKCGGSSIC EHGRQLHRCK ECGADEGTRR       300
     R                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page