(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE77

MICSR_1.PE77         Location/Qualifiers
FT   CDS             join(complement(146230..146496),complement(145548..146066))
FT                   /codon_start=1
FT                   /gene_family="HOG000204051" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636082"
FT                   /orf_name="MICPUN_80139"
FT                   /product="Predicted protein"
FT                   /function="phosphotransferase activity, for other
FT                   substituted phosphate groups"
FT                   /biological_process="phospholipid biosynthetic process "
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62068.1"
FT                   /db_xref="GO:0008654"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0016780"
FT                   /db_xref="HOGENOM:HBG523037"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014387"
FT                   /db_xref="UniParc:UPI000199ACA5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V4"
FT                   /transl_table=1
FT                   /translation="MPPRRTRSGDASSGSTTRFFQRHSNVYAYVPNIIGYVRVLLAAAA
FT                   LRLAFTDVPTSLALYALSFVCDELDGRFARMFDQCSEFGKLLDMVTDRLATTGLLMVLS
FT                   REYPDWFFTCVSLVALDVGSHWLQMYAQLLRNKSSHKDVDPSSFFILKLYYTNRIFMGA
FT                   CCVGAEVLYLAAHAATDPRIAAIAGPLRIGATPAKVSVPLPAALGWGTELGVECASALG
FT                   QLALVALPFWAVKQAANVAQLVTSCEALVAHDFPKRKRT"
     MPPRRTRSGD ASSGSTTRFF QRHSNVYAYV PNIIGYVRVL LAAAALRLAF TDVPTSLALY        60
     ALSFVCDELD GRFARMFDQC SEFGKLLDMV TDRLATTGLL MVLSREYPDW FFTCVSLVAL       120
     DVGSHWLQMY AQLLRNKSSH KDVDPSSFFI LKLYYTNRIF MGACCVGAEV LYLAAHAATD       180
     PRIAAIAGPL RIGATPAKVS VPLPAALGWG TELGVECASA LGQLALVALP FWAVKQAANV       240
     AQLVTSCEAL VAHDFPKRKR T                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page