(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE79

MICSR_1.PE79         Location/Qualifiers
FT   CDS             join(complement(150555..150851),complement(150369..150450),
FT                   complement(149716..150212))
FT                   /codon_start=1
FT                   /gene_family="HOG000091084" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636084"
FT                   /orf_name="MICPUN_107861"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /cellular_component="proteasome core complex, alpha-subunit
FT                   complex"
FT                   /protein_id="ACO62069.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="GO:0019773"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000199ACA7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V6"
FT                   /transl_table=1
FT                   /translation="MSRGSGAGYDRHITIFSPEGRLYQVGASRPEPAWRRRPNPPRPII
FT                   PSLFTPARIARLTGDPVPFPPSEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKLLD
FT                   PTDITHMFKITKTIGLCATGKLPDIRNVVQKARHTAAEFRHEYGYEIPVDYLSCKLADW
FT                   FQVYTQHAYMRPMAAMCMFVGIDEERGPSLYKNDPAGYFVGYKATSAGAKEQEAINFLE
FT                   KKVKGKDAGNTFTEQETVRTAIACLQTVLGEDLKARELEVGIVTVDDPNFRLLSETAIE
FT                   DHLTAISERD"
     MSRGSGAGYD RHITIFSPEG RLYQVGASRP EPAWRRRPNP PRPIIPSLFT PARIARLTGD        60
     PVPFPPSEYA FKAIKSVGVT SIGVRGKDSV CVVTQKKIPD KLLDPTDITH MFKITKTIGL       120
     CATGKLPDIR NVVQKARHTA AEFRHEYGYE IPVDYLSCKL ADWFQVYTQH AYMRPMAAMC       180
     MFVGIDEERG PSLYKNDPAG YFVGYKATSA GAKEQEAINF LEKKVKGKDA GNTFTEQETV       240
     RTAIACLQTV LGEDLKAREL EVGIVTVDDP NFRLLSETAI EDHLTAISER D                291
//

If you have problems or comments...

PBIL Back to PBIL home page