(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE8

MICSR_1.PE8          Location/Qualifiers
FT   CDS             19556..20161
FT                   /codon_start=1
FT                   /gene_family="HOG000157370" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636013"
FT                   /orf_name="MICPUN_79748"
FT                   /product="Predicted protein"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /protein_id="ACO61588.1"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="HOGENOM:HBG627112"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="UniParc:UPI000199AA4F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N5"
FT                   /transl_table=1
FT                   /translation="MFQISRLEDANVKILPENLGKPRLEAITQEIESLYIDKVIKDLGL
FT                   VITLYEIVSIEGGTVYPGEGSAHFKVEFRVVVFRPFVGEIIEGTLKKADKTGLYVDIGF
FT                   FSDIFVPEHLMQEPSVFDEDEQLWVWMYEDAKMFMDLEEPVRIRIQGIKFPDQPRTSDE
FT                   LVGRTALEGATPDGTFAPMVVMADINADGLGLISWWKQ"
     MFQISRLEDA NVKILPENLG KPRLEAITQE IESLYIDKVI KDLGLVITLY EIVSIEGGTV        60
     YPGEGSAHFK VEFRVVVFRP FVGEIIEGTL KKADKTGLYV DIGFFSDIFV PEHLMQEPSV       120
     FDEDEQLWVW MYEDAKMFMD LEEPVRIRIQ GIKFPDQPRT SDELVGRTAL EGATPDGTFA       180
     PMVVMADINA DGLGLISWWK Q                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page