(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE80

MICSR_1.PE80         Location/Qualifiers
FT   CDS             151072..151671
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636085"
FT                   /orf_name="MICPUN_56653"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO61623.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniParc:UPI000199ACA8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V7"
FT                   /transl_table=1
FT                   /translation="MGIRIEWSSPCGGCQKTLTKGSNAKKCGKCNSVWYCSKECQTLDW
FT                   KRPNKQGHKHRCAALAEADKLRGAGNPRSQKAFEAHDSKPMMDRFHEILQRKIQPGERA
FT                   YEVMSKMLEDGVAKGARAIMMIHEEVLGNGTIEFTVVPEAQVEVMLEDDAAFSRHALMV
FT                   RTYDPEKQFVICYETSQPERHIVFRVMAEDILNRRS"
     MGIRIEWSSP CGGCQKTLTK GSNAKKCGKC NSVWYCSKEC QTLDWKRPNK QGHKHRCAAL        60
     AEADKLRGAG NPRSQKAFEA HDSKPMMDRF HEILQRKIQP GERAYEVMSK MLEDGVAKGA       120
     RAIMMIHEEV LGNGTIEFTV VPEAQVEVML EDDAAFSRHA LMVRTYDPEK QFVICYETSQ       180
     PERHIVFRVM AEDILNRRS                                                    199
//

If you have problems or comments...

PBIL Back to PBIL home page