(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE82

MICSR_1.PE82         Location/Qualifiers
FT   CDS             join(complement(155144..155314),complement(154194..154802))
FT                   /codon_start=1
FT                   /gene_family="HOG000238033" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636087"
FT                   /gene_name="LHCP3"
FT                   /orf_name="MICPUN_90184"
FT                   /product="Prasinophyte specific chlorophyll a/b-binding
FT                   protein, chloroplast"
FT                   /biological_process="photosynthesis, light harvesting "
FT                   /cellular_component="chloroplast"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62071.1"
FT                   /db_xref="GO:0009507"
FT                   /db_xref="GO:0009765"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG618504"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="UniParc:UPI000199ACAA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V9"
FT                   /transl_table=1
FT                   /translation="MALTMSNALVGTGLVAKPAVRSVQARAGLKVFARMTKDRVSLKKD
FT                   TKLGKSRIEIYPEWGEFPSSERTSPLTSLTYDEYKNNVSTEIIHGRFAMLGVTGAWAQE
FT                   NLTGIPWFMAGQECTFDNCSISYLNQSFTPSYDGALLGLIFLEVLLMGYAEGTRTGLIE
FT                   NPFDDVVAGSVFPGGRFDPLNFSDGKEANFFGDDLDTLKIKELKHCRLAMLAWLGILAQ
FT                   SVSTNPEGTEIGPVANWSAHVADVVHCNVVDRSGCVF"
     MALTMSNALV GTGLVAKPAV RSVQARAGLK VFARMTKDRV SLKKDTKLGK SRIEIYPEWG        60
     EFPSSERTSP LTSLTYDEYK NNVSTEIIHG RFAMLGVTGA WAQENLTGIP WFMAGQECTF       120
     DNCSISYLNQ SFTPSYDGAL LGLIFLEVLL MGYAEGTRTG LIENPFDDVV AGSVFPGGRF       180
     DPLNFSDGKE ANFFGDDLDT LKIKELKHCR LAMLAWLGIL AQSVSTNPEG TEIGPVANWS       240
     AHVADVVHCN VVDRSGCVF                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page