(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE83

MICSR_1.PE83         Location/Qualifiers
FT   CDS             join(155861..156049,156202..157578)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636088"
FT                   /orf_name="MICPUN_99274"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61624.1"
FT                   /db_xref="UniParc:UPI000199A640"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W0"
FT                   /transl_table=1
FT                   /translation="MSAVVAGNLLALAGTAKPLKRGRSATRTRRVVSAAANADDARVAD
FT                   VKRAVVATLASAAIALPAIAAPVAEIALTPEEQIAAEVAKFEEQRAKCGTSACRDTVTQ
FT                   WESAAVKKIKKKAGIPLDAPAPKAYPTPKRVAPAPVAETEAAPAPAAAPEATSQPAPRA
FT                   AAGPPVDAKADAKARLAERQAASAAAAEKAAAEKAAKAEALRQAQADAQAERVAAAKAA
FT                   AEAAEAKRAAAAAAKADAKADAKPAPAPAKKAAPAPPPAKKAAPAPAKKTAAKPKSPGV
FT                   FDYVVGDVTVAALGSAAALALVAPSFKDKALAGDASGALEEVKGLVTGANQDAAIGKAC
FT                   LLGGVVAADALIHLPVLGFFLPGPAEFVGTVAATLLAAKYFVTREASYEEDIKDFAASI
FT                   PAGVPDVASTVVEPITKFVGAVKAPDADALVGDFNEWFNGLDDPVEEIAPKAAAFGACV
FT                   AVSYVAHFPVLGLVLPRVLELVGVYVCGGAVARYGEAGTVSLKADLIKVGDDAGAIVKS
FT                   VVSK"
     MSAVVAGNLL ALAGTAKPLK RGRSATRTRR VVSAAANADD ARVADVKRAV VATLASAAIA        60
     LPAIAAPVAE IALTPEEQIA AEVAKFEEQR AKCGTSACRD TVTQWESAAV KKIKKKAGIP       120
     LDAPAPKAYP TPKRVAPAPV AETEAAPAPA AAPEATSQPA PRAAAGPPVD AKADAKARLA       180
     ERQAASAAAA EKAAAEKAAK AEALRQAQAD AQAERVAAAK AAAEAAEAKR AAAAAAKADA       240
     KADAKPAPAP AKKAAPAPPP AKKAAPAPAK KTAAKPKSPG VFDYVVGDVT VAALGSAAAL       300
     ALVAPSFKDK ALAGDASGAL EEVKGLVTGA NQDAAIGKAC LLGGVVAADA LIHLPVLGFF       360
     LPGPAEFVGT VAATLLAAKY FVTREASYEE DIKDFAASIP AGVPDVASTV VEPITKFVGA       420
     VKAPDADALV GDFNEWFNGL DDPVEEIAPK AAAFGACVAV SYVAHFPVLG LVLPRVLELV       480
     GVYVCGGAVA RYGEAGTVSL KADLIKVGDD AGAIVKSVVS K                           521
//

If you have problems or comments...

PBIL Back to PBIL home page