(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE84

MICSR_1.PE84         Location/Qualifiers
FT   CDS             157786..159048
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636089"
FT                   /orf_name="MICPUN_56657"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61625.1"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniParc:UPI000199A641"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W1"
FT                   /transl_table=1
FT                   /translation="MELPEDLVERIAETCVRAGGLKEWCRSWRGTCRRFSSLRWFEAVA
FT                   RGGVPLAVVPSDRCPTVQLGVSRARSATEDAVARAAATRRALSRIAGRSEDDDDDDDDD
FT                   DDGWDVLGTGPTVLVTPGVHRENVRLTRTCALIGWGSRGSAVIEGSGWEPALAFAGLGM
FT                   SERGTGDTMGWSVGDTGERSVACNLSIRSRNRAQAFAVAVVNGAPKFVRCDLRGGLLVL
FT                   GWKTSPAALACVVRDGRGCGVKVTDHGEARLDGCVVERCGTHGLLLERGGRAVLAGRTV
FT                   VRDNDLEAVLHTPDTDGVALEGEGVDLGPPAIVRVGVRKYDSDDEEGDSGHVSVVVRPN
FT                   VRRLRVGAETLEHLHGHAPDYAWLKRGGFSFDDDGGDEDYEEEEATGSDYDEEETGSDY
FT                   DFDDDDEGVSASPRINEPYRE"
     MELPEDLVER IAETCVRAGG LKEWCRSWRG TCRRFSSLRW FEAVARGGVP LAVVPSDRCP        60
     TVQLGVSRAR SATEDAVARA AATRRALSRI AGRSEDDDDD DDDDDDGWDV LGTGPTVLVT       120
     PGVHRENVRL TRTCALIGWG SRGSAVIEGS GWEPALAFAG LGMSERGTGD TMGWSVGDTG       180
     ERSVACNLSI RSRNRAQAFA VAVVNGAPKF VRCDLRGGLL VLGWKTSPAA LACVVRDGRG       240
     CGVKVTDHGE ARLDGCVVER CGTHGLLLER GGRAVLAGRT VVRDNDLEAV LHTPDTDGVA       300
     LEGEGVDLGP PAIVRVGVRK YDSDDEEGDS GHVSVVVRPN VRRLRVGAET LEHLHGHAPD       360
     YAWLKRGGFS FDDDGGDEDY EEEEATGSDY DEEETGSDYD FDDDDEGVSA SPRINEPYRE       420
//

If you have problems or comments...

PBIL Back to PBIL home page