(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE85

MICSR_1.PE85         Location/Qualifiers
FT   CDS             complement(<159790..160146)
FT                   /codon_start=1
FT                   /gene_family="HOG000198753" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636090"
FT                   /orf_name="MICPUN_80006"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="mismatched DNA binding"
FT                   /biological_process="mismatch repair"
FT                   /protein_id="ACO62072.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006298"
FT                   /db_xref="GO:0030983"
FT                   /db_xref="HOGENOM:HBG241590"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="UniParc:UPI000199A642"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W2"
FT                   /transl_table=1
FT                   /translation="MLLTGPNMGGKSTLLRQAALAVVAAHVGCRVPASACELHVVDAVY
FT                   CRVGAGDGIRSGVSTFFAEMSETAAALNAATDKSLLVIDELGRGTSTADGYAIAYAVAS
FT                   AVAERGSRCLFATHY"
     MLLTGPNMGG KSTLLRQAAL AVVAAHVGCR VPASACELHV VDAVYCRVGA GDGIRSGVST        60
     FFAEMSETAA ALNAATDKSL LVIDELGRGT STADGYAIAY AVASAVAERG SRCLFATHY        119
//

If you have problems or comments...

PBIL Back to PBIL home page