(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE86

MICSR_1.PE86         Location/Qualifiers
FT   CDS             complement(163903..167667)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636091"
FT                   /orf_name="MICPUN_56659"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62073.1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR022364"
FT                   /db_xref="UniParc:UPI000199A643"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W3"
FT                   /transl_table=1
FT                   /translation="MRASFFRSRVVGKEKKGRGKGRAESTDEWDARVAEVDALRDSSLG
FT                   CLPRSIFADVVSRLDGPDVARLGMTCRAARAYCSRPAIWRALARAQEAPALVREDLVNR
FT                   DFTWKQLYAWRRHVLWHRARGVDRIAVADHARVLTCDPVEGGGRVRVAYEAPSPQPLAP
FT                   NLLTWSPDASMLVVAQESAEGCKLVLSAPTACLRPKRSNRFASGDRQFQILDRRRRGTG
FT                   HDRGDGYDSEDATMGDEDSTAAAGHGLGTSGRTQTAGRTQQLAGTNAAFFGRGDSGGGQ
FT                   SGGAAWQQLDDEDDSVDANKAKEPRAYPRGIVAPIDRVRSHKLPAMNSVHVPLRNPVFA
FT                   AFTACGTRLLLMNVRRHGEEFALHELDLTVAMASLHGATPGAAGTRGSKFLAKNHQFKN
FT                   HQSLAGTKRRRGDFVAGDDDDAAAAPANVRGVGPDGWLSADARETLTLVESGRELSFSP
FT                   GPSTRDVLSLVNGAAVGKISPANLRAWSGLDRECTARPVAGGARDRVRAARALERDEDV
FT                   RMNERLRKEENETASEASFELDGDELEEERDNRASTGNTHPAWRAGGGADGGAVEGAVW
FT                   GAHAASDDDEGGLREVSSAPESLWWRRSVDAFRGGYSAGVETLRSAAVQLARSLLPAAI
FT                   VHPAGVRRGGSSRRRGGGSVWGAGRGEREEAAMRRAAEVERRSRSGGRAIKRARLTGRA
FT                   AAAGGAAGGGGDRSRAPVVGGFSRLGKAKKGSGPSASVGYVNPFACAIPSVRRARPSDV
FT                   VSFRRDRLHETSLPGLAHIVQWVRPARDVPSVGRGSNLVAGDSPGGDSPGDHGHWLVPV
FT                   SFPDAMPRAVHLALLPAAPTPGPNEIRGTDAQRRESARLAMLGLDASMPRSAASRVAAA
FT                   VERSVIAARSLFSKDARHPSAPVGAPVGTLEDACVVELAPPAAYNELHVVVSTVAAAAP
FT                   GGKIVCWADDGALWARRAVDGPDGNRTWDRATRVLDLRRCGFGADAGLRIDDEGSVAPN
FT                   PVLHQVCAMQWSASGTRLLILVACHFTTTSHVFPMHQWMVWDPPATWLGASDLSLLEDP
FT                   PSATTHGAGCFAASGGGPGAPVFCRCVSRSYDDALAGDFRCSHGRDRYRCEECGGAGVG
FT                   EDAIDPGTLDSIRARVHETGAYGFDPDDVLGVITRGRWHVPTKTFVQDVLPIFEQYSQT
FT                   HSLWAPDEDRVCYPVRSDGSGAGAGVGGGDHVWMTRFPRMPIVHRLASVGGGRNVRQVG
FT                   EHNALPFKHAFVDSAVVVCEGSFCVWSPC"
     MRASFFRSRV VGKEKKGRGK GRAESTDEWD ARVAEVDALR DSSLGCLPRS IFADVVSRLD        60
     GPDVARLGMT CRAARAYCSR PAIWRALARA QEAPALVRED LVNRDFTWKQ LYAWRRHVLW       120
     HRARGVDRIA VADHARVLTC DPVEGGGRVR VAYEAPSPQP LAPNLLTWSP DASMLVVAQE       180
     SAEGCKLVLS APTACLRPKR SNRFASGDRQ FQILDRRRRG TGHDRGDGYD SEDATMGDED       240
     STAAAGHGLG TSGRTQTAGR TQQLAGTNAA FFGRGDSGGG QSGGAAWQQL DDEDDSVDAN       300
     KAKEPRAYPR GIVAPIDRVR SHKLPAMNSV HVPLRNPVFA AFTACGTRLL LMNVRRHGEE       360
     FALHELDLTV AMASLHGATP GAAGTRGSKF LAKNHQFKNH QSLAGTKRRR GDFVAGDDDD       420
     AAAAPANVRG VGPDGWLSAD ARETLTLVES GRELSFSPGP STRDVLSLVN GAAVGKISPA       480
     NLRAWSGLDR ECTARPVAGG ARDRVRAARA LERDEDVRMN ERLRKEENET ASEASFELDG       540
     DELEEERDNR ASTGNTHPAW RAGGGADGGA VEGAVWGAHA ASDDDEGGLR EVSSAPESLW       600
     WRRSVDAFRG GYSAGVETLR SAAVQLARSL LPAAIVHPAG VRRGGSSRRR GGGSVWGAGR       660
     GEREEAAMRR AAEVERRSRS GGRAIKRARL TGRAAAAGGA AGGGGDRSRA PVVGGFSRLG       720
     KAKKGSGPSA SVGYVNPFAC AIPSVRRARP SDVVSFRRDR LHETSLPGLA HIVQWVRPAR       780
     DVPSVGRGSN LVAGDSPGGD SPGDHGHWLV PVSFPDAMPR AVHLALLPAA PTPGPNEIRG       840
     TDAQRRESAR LAMLGLDASM PRSAASRVAA AVERSVIAAR SLFSKDARHP SAPVGAPVGT       900
     LEDACVVELA PPAAYNELHV VVSTVAAAAP GGKIVCWADD GALWARRAVD GPDGNRTWDR       960
     ATRVLDLRRC GFGADAGLRI DDEGSVAPNP VLHQVCAMQW SASGTRLLIL VACHFTTTSH      1020
     VFPMHQWMVW DPPATWLGAS DLSLLEDPPS ATTHGAGCFA ASGGGPGAPV FCRCVSRSYD      1080
     DALAGDFRCS HGRDRYRCEE CGGAGVGEDA IDPGTLDSIR ARVHETGAYG FDPDDVLGVI      1140
     TRGRWHVPTK TFVQDVLPIF EQYSQTHSLW APDEDRVCYP VRSDGSGAGA GVGGGDHVWM      1200
     TRFPRMPIVH RLASVGGGRN VRQVGEHNAL PFKHAFVDSA VVVCEGSFCV WSPC            1254
//

If you have problems or comments...

PBIL Back to PBIL home page