(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE87

MICSR_1.PE87         Location/Qualifiers
FT   CDS             complement(168219..169832)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636092"
FT                   /orf_name="MICPUN_56660"
FT                   /product="Predicted protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62074.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="UniParc:UPI000199A644"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W4"
FT                   /transl_table=1
FT                   /translation="MLNGQNNYQTAPPGGGGFPLVGSHGNMQGMQYGMGPGRGPGGMQG
FT                   APQARGQFMGGMQGGMQGGGMGNPPGVFNAQAQMNGGLGLGGAPPGLGGSPGGARASMD
FT                   RTGSGGQLLARQGSMPGAANGGMMGPNAGAGPRGMMAGGGSFGGGGGGGIPGPRGSGPD
FT                   LLAMINKGGAGSPFGAQGGMGMGGMGEDQTPFDMSEFPSLGGPPPGARGGLGGQPGAQG
FT                   AFGGMGPGQGGVFGGMDGMGSMGDGYGAMALQKPHPEFTIQNEDFPALPGAPGGGGGGG
FT                   GGASKGGGGPALGQPGPFAQGPQGGKLDLNGPMGGGAPYEFGGGKGSGGGKGVGGGQMA
FT                   AATDRFGLLGLLGVIRMSDPDLTTLALGTDLTTLGLNLNSPEPLYKTFGSPWADTPPRP
FT                   EVELLLPACYSVPVAGVRPAVFQKFQQETLFYVFYSMPGDESQLFAADELCARGWGFHK
FT                   ELKAWIMRVAGTEPVMKSERGERGSFWIFDVMSWERIRKDNFNLQYDQLEARPETGDKG
FT                   AGGKETKPPAGGLLTASAGK"
     MLNGQNNYQT APPGGGGFPL VGSHGNMQGM QYGMGPGRGP GGMQGAPQAR GQFMGGMQGG        60
     MQGGGMGNPP GVFNAQAQMN GGLGLGGAPP GLGGSPGGAR ASMDRTGSGG QLLARQGSMP       120
     GAANGGMMGP NAGAGPRGMM AGGGSFGGGG GGGIPGPRGS GPDLLAMINK GGAGSPFGAQ       180
     GGMGMGGMGE DQTPFDMSEF PSLGGPPPGA RGGLGGQPGA QGAFGGMGPG QGGVFGGMDG       240
     MGSMGDGYGA MALQKPHPEF TIQNEDFPAL PGAPGGGGGG GGGASKGGGG PALGQPGPFA       300
     QGPQGGKLDL NGPMGGGAPY EFGGGKGSGG GKGVGGGQMA AATDRFGLLG LLGVIRMSDP       360
     DLTTLALGTD LTTLGLNLNS PEPLYKTFGS PWADTPPRPE VELLLPACYS VPVAGVRPAV       420
     FQKFQQETLF YVFYSMPGDE SQLFAADELC ARGWGFHKEL KAWIMRVAGT EPVMKSERGE       480
     RGSFWIFDVM SWERIRKDNF NLQYDQLEAR PETGDKGAGG KETKPPAGGL LTASAGK          537
//

If you have problems or comments...

PBIL Back to PBIL home page