(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE88

MICSR_1.PE88         Location/Qualifiers
FT   CDS             170740..171867
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636093"
FT                   /orf_name="MICPUN_56661"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61626.1"
FT                   /db_xref="UniParc:UPI000199A645"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W5"
FT                   /transl_table=1
FT                   /translation="MAPADTAGLERLVRTVRSDAEQRKRLVCNACFLAALAQLHPEVVA
FT                   KPKGERRWRREELDALAAATAGRIDDADPVHVIVGVDDLNVNIRYMKGSLVYLRAETNP
FT                   PLRCMMYSSMPPPPGQEEPSADDSADGPKTPGQDETADLPTGPAKVLDDADASHALVRA
FT                   VLERLNDDPTIDTAGGGVDADDPEAVATWRAARVRESLTAAHGAHWHVVHDAKPFGAAV
FT                   VTSGEGRRVLAQRGRYSFLVWRHSSSIKSPLEAIRRRIRADLPALRRGARTTFLVVCAV
FT                   YALWYRAMCREEEEEGGGGGAGGGTRPNDDRTAVGIIAGAEPRLTTFLCAAGESAAPFA
FT                   FFALAVMFALGGGGTASAIGARYARAFARRKRKSA"
     MAPADTAGLE RLVRTVRSDA EQRKRLVCNA CFLAALAQLH PEVVAKPKGE RRWRREELDA        60
     LAAATAGRID DADPVHVIVG VDDLNVNIRY MKGSLVYLRA ETNPPLRCMM YSSMPPPPGQ       120
     EEPSADDSAD GPKTPGQDET ADLPTGPAKV LDDADASHAL VRAVLERLND DPTIDTAGGG       180
     VDADDPEAVA TWRAARVRES LTAAHGAHWH VVHDAKPFGA AVVTSGEGRR VLAQRGRYSF       240
     LVWRHSSSIK SPLEAIRRRI RADLPALRRG ARTTFLVVCA VYALWYRAMC REEEEEGGGG       300
     GAGGGTRPND DRTAVGIIAG AEPRLTTFLC AAGESAAPFA FFALAVMFAL GGGGTASAIG       360
     ARYARAFARR KRKSA                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page