(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE89

MICSR_1.PE89         Location/Qualifiers
FT   CDS             172023..173102
FT                   /codon_start=1
FT                   /gene_family="HOG000264812" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636094"
FT                   /orf_name="MICPUN_56662"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="ACO61627.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG560508"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI000199A646"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W6"
FT                   /transl_table=1
FT                   /translation="MSFALASLQGRALASPLHVKRTAPRRGTRAVLVRAAVDPERDVIL
FT                   VSGCRERVAQCCVDQLSKNERSAGVVIKVTLPHDAYVGVKNPLNAMAKDLVFPDKPMID
FT                   CLGALDAVECVDESTDLFKGCLKDATGVILASEYAPTLLQTAVDLCDRIKAGAMPKLRR
FT                   VVVLSHIGVERRDVDPWKFMNRKTMVGTGVIGGKPQPGGAPLDRWVDAEELIKATLESC
FT                   GGADKSPWSYTIIRVGDLRGNGPTSVTYGDAMLTLVDNAFDVRMQDIEMEEGDAFEGFT
FT                   KRLSVAVVMNRMLTTQSYRVINRTFSCISTGPVDRERRKGWDVAKGRSPPPIEDKVVDE
FT                   ELQPKEEEENVPAGAPVPT"
     MSFALASLQG RALASPLHVK RTAPRRGTRA VLVRAAVDPE RDVILVSGCR ERVAQCCVDQ        60
     LSKNERSAGV VIKVTLPHDA YVGVKNPLNA MAKDLVFPDK PMIDCLGALD AVECVDESTD       120
     LFKGCLKDAT GVILASEYAP TLLQTAVDLC DRIKAGAMPK LRRVVVLSHI GVERRDVDPW       180
     KFMNRKTMVG TGVIGGKPQP GGAPLDRWVD AEELIKATLE SCGGADKSPW SYTIIRVGDL       240
     RGNGPTSVTY GDAMLTLVDN AFDVRMQDIE MEEGDAFEGF TKRLSVAVVM NRMLTTQSYR       300
     VINRTFSCIS TGPVDRERRK GWDVAKGRSP PPIEDKVVDE ELQPKEEEEN VPAGAPVPT        359
//

If you have problems or comments...

PBIL Back to PBIL home page