(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE9

MICSR_1.PE9          Location/Qualifiers
FT   CDS             complement(20306..21181)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636014"
FT                   /orf_name="MICPUN_56580"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62033.1"
FT                   /db_xref="UniParc:UPI000199AA50"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N6"
FT                   /transl_table=1
FT                   /translation="MAHVSTMMSRISITAPLHASPHRPAGAGSRRAAVTVRAGKGKGAK
FT                   YRRGADDPYAKEKNKDKMEKQTKAKQSAEDGPLNSVFSKEEPKEEYFLFVRKLRVDGSG
FT                   AAAPAADSDAEKKSVDEGEYSSANIGAMLGMKGPNTDGSGSKISSLGNWLPLGDVSIEA
FT                   GGDLDVVVAERRRMLVKFAKVKHLKLLPVCADEKLEFGVRVQRGPPRGTDPTAVFPVAT
FT                   DAEHEELVWDHETMGEEGSVRAELRLMQSLPSLGKGKKNEMLSSAMDMIKRQQEQAAAM
FT                   KAEREKVDDA"
     MAHVSTMMSR ISITAPLHAS PHRPAGAGSR RAAVTVRAGK GKGAKYRRGA DDPYAKEKNK        60
     DKMEKQTKAK QSAEDGPLNS VFSKEEPKEE YFLFVRKLRV DGSGAAAPAA DSDAEKKSVD       120
     EGEYSSANIG AMLGMKGPNT DGSGSKISSL GNWLPLGDVS IEAGGDLDVV VAERRRMLVK       180
     FAKVKHLKLL PVCADEKLEF GVRVQRGPPR GTDPTAVFPV ATDAEHEELV WDHETMGEEG       240
     SVRAELRLMQ SLPSLGKGKK NEMLSSAMDM IKRQQEQAAA MKAEREKVDD A                291
//

If you have problems or comments...

PBIL Back to PBIL home page