(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE90

MICSR_1.PE90         Location/Qualifiers
FT   CDS             join(complement(177168..177194),complement(176382..176828))
FT                   /codon_start=1
FT                   /gene_family="HOG000012544" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636095"
FT                   /gene_name="PSAN"
FT                   /orf_name="MICPUN_93625"
FT                   /product="Photosystem I subunit N, chloroplast "
FT                   /biological_process="photosynthesis"
FT                   /cellular_component="photosystem I"
FT                   /cellular_component="thylakoid membrane"
FT                   /protein_id="ACO62075.1"
FT                   /db_xref="GO:0009522"
FT                   /db_xref="GO:0015979"
FT                   /db_xref="GO:0042651"
FT                   /db_xref="InterPro:IPR008796"
FT                   /db_xref="UniParc:UPI000199A647"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W7"
FT                   /transl_table=1
FT                   /translation="MAAMTVCAPAMLSSKVSTGIKAKATAAKASKAQGAVCFFGDAKKA
FT                   AAATLAAAVLVAGPAMPAKADLTSDLLARTEANKELNDKKRAATSSANFERSRTVTDGV
FT                   CKFPQNMLGCEIASSTGDVAFLSADKALECEGTRDGKVCASKAPGSFPPVFGM"
     MAAMTVCAPA MLSSKVSTGI KAKATAAKAS KAQGAVCFFG DAKKAAAATL AAAVLVAGPA        60
     MPAKADLTSD LLARTEANKE LNDKKRAATS SANFERSRTV TDGVCKFPQN MLGCEIASST       120
     GDVAFLSADK ALECEGTRDG KVCASKAPGS FPPVFGM                                157
//

If you have problems or comments...

PBIL Back to PBIL home page