(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE91

MICSR_1.PE91         Location/Qualifiers
FT   CDS             178847..181057
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636096"
FT                   /orf_name="MICPUN_52126"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61628.1"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="UniParc:UPI000199A648"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W8"
FT                   /transl_table=1
FT                   /translation="MRPMANGAGGSKGGDAGPAPVVDSANDPMAISETWRRFMDAHVAG
FT                   VGIGTMDDSREWASTALTRLREEEDENRRRMDAVVTPDGRDANGEIVFPVKKDNSFVDL
FT                   LAVAKDDEAARCAVLLALALEAAETEARVAWNKLRAELRWKEPFAPAEKSAALESAHSL
FT                   DSAGDDNGVGGRRLGRRASGVADLDDIIIESPGEFLEQRRNSVAGWDAGAGVGRGGAWL
FT                   LEPLRDRWEARRVLEWSPWVMSEASVGASGELAILSGGGDGDAEGGVAEGGVAEGAPAA
FT                   AADEGAVVGLRGAKEEAARRRAAMTEEPNYVVESVPTQRAFDWTSLVPAASVPQVSVQE
FT                   VISVDAGDDLSSPSSAPGSPKGPGLEDPGSPTSKSIHSVTSDASTINIDALTDLRYGEH
FT                   MVFLVHGYAGSLQDLRLLRAHLQVACPNVHTRVSAANHERTGVDSIEAMGARLAEEVAE
FT                   TMEDLESGALVPRGGGREPRSPAAAAATTAARFGAPPRVSFAAHSVGVLIVRAALTHPA
FT                   MEPYLSRLHLFLSMSGPHLGYAGGDRVGADGMDKKSRRFIGKSAAFQLGLCCTRAINPK
FT                   AKCLSEITFRDAGKIEDCYLYRLAHHKNGLALFRHVVLVSSPQDKYVQRHSARLQLEGF
FT                   RIREGSRRARATMEMARAILAPVLEKAISRERGEAGSSGRDGVERESGARLTSLSRVDV
FT                   HFAKVGGGVDFNQLIGRKAHIDFLETDEYVRFLIWKLRRAFL"
     MRPMANGAGG SKGGDAGPAP VVDSANDPMA ISETWRRFMD AHVAGVGIGT MDDSREWAST        60
     ALTRLREEED ENRRRMDAVV TPDGRDANGE IVFPVKKDNS FVDLLAVAKD DEAARCAVLL       120
     ALALEAAETE ARVAWNKLRA ELRWKEPFAP AEKSAALESA HSLDSAGDDN GVGGRRLGRR       180
     ASGVADLDDI IIESPGEFLE QRRNSVAGWD AGAGVGRGGA WLLEPLRDRW EARRVLEWSP       240
     WVMSEASVGA SGELAILSGG GDGDAEGGVA EGGVAEGAPA AAADEGAVVG LRGAKEEAAR       300
     RRAAMTEEPN YVVESVPTQR AFDWTSLVPA ASVPQVSVQE VISVDAGDDL SSPSSAPGSP       360
     KGPGLEDPGS PTSKSIHSVT SDASTINIDA LTDLRYGEHM VFLVHGYAGS LQDLRLLRAH       420
     LQVACPNVHT RVSAANHERT GVDSIEAMGA RLAEEVAETM EDLESGALVP RGGGREPRSP       480
     AAAAATTAAR FGAPPRVSFA AHSVGVLIVR AALTHPAMEP YLSRLHLFLS MSGPHLGYAG       540
     GDRVGADGMD KKSRRFIGKS AAFQLGLCCT RAINPKAKCL SEITFRDAGK IEDCYLYRLA       600
     HHKNGLALFR HVVLVSSPQD KYVQRHSARL QLEGFRIREG SRRARATMEM ARAILAPVLE       660
     KAISRERGEA GSSGRDGVER ESGARLTSLS RVDVHFAKVG GGVDFNQLIG RKAHIDFLET       720
     DEYVRFLIWK LRRAFL                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page