(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE93

MICSR_1.PE93         Location/Qualifiers
FT   CDS             183379..183975
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636098"
FT                   /orf_name="MICPUN_56666"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61629.1"
FT                   /db_xref="UniParc:UPI000199A64A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X0"
FT                   /transl_table=1
FT                   /translation="MDAQQLERYANLAPCFFAVIGVVFMAKCKVAWHPILNKTGWKKDG
FT                   VFACSADSVFLRWASLVSHTFFIIGAVIFGNGILAISNVLGLPLVLGFWCASSSIIQSI
FT                   MYMAVFKQSPMGTPDIDGPPVPARVVIAAVWIITTANYIVNRATLYRDVDETRLFGLMA
FT                   VGVFLPAAIGAKHRTKNWRLHYMKDLPARDEAKTY"
     MDAQQLERYA NLAPCFFAVI GVVFMAKCKV AWHPILNKTG WKKDGVFACS ADSVFLRWAS        60
     LVSHTFFIIG AVIFGNGILA ISNVLGLPLV LGFWCASSSI IQSIMYMAVF KQSPMGTPDI       120
     DGPPVPARVV IAAVWIITTA NYIVNRATLY RDVDETRLFG LMAVGVFLPA AIGAKHRTKN       180
     WRLHYMKDLP ARDEAKTY                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page