(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE95

MICSR_1.PE95         Location/Qualifiers
FT   CDS             186102..186791
FT                   /codon_start=1
FT                   /gene_family="HOG000123402" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636100"
FT                   /orf_name="MICPUN_56668"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61630.1"
FT                   /db_xref="HOGENOM:HBG409904"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="UniParc:UPI000199A64C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X2"
FT                   /transl_table=1
FT                   /translation="MCAPIRASYRRDNVVESVFEYTQLSLDTSLGISLHDITPQVRRAI
FT                   RESGVTNGTVNVLSRHTTTAVTINEAEGRLMDDIRQYMLKLAPPGDPYLHNDIHLRDGP
FT                   PDWPGGNDAWRAQEPRNAHSHLLSILIGNTLAVPVVDGELAIGTWQSLMLVELDGPRKR
FT                   TVGVQVCGTRSGMGDKPKRIDTSESSSNAASKSYQKKASPVSDGYKDPMDALCEDDPSA
FT                   DECKVFD"
     MCAPIRASYR RDNVVESVFE YTQLSLDTSL GISLHDITPQ VRRAIRESGV TNGTVNVLSR        60
     HTTTAVTINE AEGRLMDDIR QYMLKLAPPG DPYLHNDIHL RDGPPDWPGG NDAWRAQEPR       120
     NAHSHLLSIL IGNTLAVPVV DGELAIGTWQ SLMLVELDGP RKRTVGVQVC GTRSGMGDKP       180
     KRIDTSESSS NAASKSYQKK ASPVSDGYKD PMDALCEDDP SADECKVFD                   229
//

If you have problems or comments...

PBIL Back to PBIL home page