(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE96

MICSR_1.PE96         Location/Qualifiers
FT   CDS             complement(186865..187356)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636101"
FT                   /orf_name="MICPUN_107866"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62078.1"
FT                   /db_xref="UniParc:UPI000199A64D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X3"
FT                   /transl_table=1
FT                   /translation="MGPRPGWCFKADRHGLGYYRDPVQERREPEVPHHRATRNADRDKP
FT                   SPLYHAGEETEEPTYGHHHRGGRSATHHGGDGSQNRGNSIGTRPVVRQSKLFRRHESGN
FT                   AMKDILGNGGAMKWDENRMQGGYSGATYDHEAHNDALLRQHEQASILREVLSEVRGGQR
FT                   "
     MGPRPGWCFK ADRHGLGYYR DPVQERREPE VPHHRATRNA DRDKPSPLYH AGEETEEPTY        60
     GHHHRGGRSA THHGGDGSQN RGNSIGTRPV VRQSKLFRRH ESGNAMKDIL GNGGAMKWDE       120
     NRMQGGYSGA TYDHEAHNDA LLRQHEQASI LREVLSEVRG GQR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page