(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE97

MICSR_1.PE97         Location/Qualifiers
FT   CDS             join(188489..189762,189806..189812)
FT                   /codon_start=1
FT                   /gene_family="HOG000264720" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636102"
FT                   /orf_name="MICPUN_99282"
FT                   /product="Amino Acid/Auxin permease "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61631.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG609092"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniParc:UPI000199A6B3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X4"
FT                   /transl_table=1
FT                   /translation="MSSPPWSPTREPHGRYEELAQVDEYGTMRPTPQNDDVSDQASDDA
FT                   LVHHDDSSGWAQTPAWNICLNAAMYCAVPLSMPATLAAGGWFWGTVFFAYATFATYWTG
FT                   LVIGRVYLEHPRLATYPAMASEAFHNLALERTNGDARVARNWRTWSRRAVKITQFATFY
FT                   LDTVTQMIYVAQYFAQLDLGWFGTGAGRDEGDEIQSDSPAGRPRLCQWAWVLVVWAVSV
FT                   PVMQIPTFHASRWVIVPAVAVLAVSVALFLYEVAVVVKPWSCEPGPSFGGVTLPSAMVS
FT                   LGNMAYAYGGHGVFPESLREMREPHRWPSVMRWMYAGLVPAYVVCAVVGYAGYGRFAQA
FT                   NINLNFPKNWVNGVSITLQLLQCYYLIFYTNVVLVLMVETRWGIDPTKTWRPRTSLPVI
FT                   GSTSPAVARMLFRTAFLGTQVALAEWR"
     MSSPPWSPTR EPHGRYEELA QVDEYGTMRP TPQNDDVSDQ ASDDALVHHD DSSGWAQTPA        60
     WNICLNAAMY CAVPLSMPAT LAAGGWFWGT VFFAYATFAT YWTGLVIGRV YLEHPRLATY       120
     PAMASEAFHN LALERTNGDA RVARNWRTWS RRAVKITQFA TFYLDTVTQM IYVAQYFAQL       180
     DLGWFGTGAG RDEGDEIQSD SPAGRPRLCQ WAWVLVVWAV SVPVMQIPTF HASRWVIVPA       240
     VAVLAVSVAL FLYEVAVVVK PWSCEPGPSF GGVTLPSAMV SLGNMAYAYG GHGVFPESLR       300
     EMREPHRWPS VMRWMYAGLV PAYVVCAVVG YAGYGRFAQA NINLNFPKNW VNGVSITLQL       360
     LQCYYLIFYT NVVLVLMVET RWGIDPTKTW RPRTSLPVIG STSPAVARML FRTAFLGTQV       420
     ALAEWR                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page