(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE99

MICSR_1.PE99         Location/Qualifiers
FT   CDS             191201..193954
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636104"
FT                   /orf_name="MICPUN_56672"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61632.1"
FT                   /db_xref="UniParc:UPI000199A6B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X6"
FT                   /transl_table=1
FT                   /translation="MAQTSRSTDIKVTRAMRDATNSVAPRDIAPKPPAEGKENSKYDGF
FT                   FFADPAGLTTPAPAFPTKTMDPSPTSVLMGPGTPDEAAEQRPREKATPENATDDGADAE
FT                   MTLATSPSDGESVDDDVASPESPERPATVPDLAVASTSPFVPNVLEELLGAQLPRAESN
FT                   VRARRDAAGNLAANGAPQSAQTRRVQHATSTPTSATSTRWRSVPSPAQIVSMGREWAAS
FT                   GTVTPGRSTAIPTFLDDLVNNHVAKVAVDTKGTNTESNNTDEWDRTGDLKVECERLKRE
FT                   VDFHREVSKEVGVSLDASAAELERTKRRVEFLEALKDEWDAQFKELSAETERYRAEADA
FT                   AREETLAAEALAAAARAAATSANAEAESLRKNVIHDDDGSTGEAPETSGTTSTSASATS
FT                   AEVGSAALFRRHRSGAENDVAASIAAALRERESELDAARLNLDQTLAAAKAAEAKLAAK
FT                   CEECAALRGEVNVAKSTLAAAREAVAQTEGALMTTLEDKKRLVEDKKRLIKKIEMMETD
FT                   ADAKARDACERVRDATERGRRSVLRARANWGAVALTTAALALGVCAWAAAVPPAGVLIA
FT                   VPFGIDFRDWRLGSDGSTSAFNAGFNVRTVNFTLPGAGYAVAAELSACRADLATSTALA
FT                   SALSSEASRFAGLAEENDRLAAEVEDFARVTESLREREADVRSLESRLAHLEASANDAA
FT                   TRGDDPFAASLAARAETERLRHALAKERSLRRRSAFLEKLDVVSIAAVCVAWGTCLLSA
FT                   WFFARKESGLRRTLNDYGALMEAASAEHERLGSELTRATLDANEERTRRERSEGRAREL
FT                   ERQLDASRKAANEATKRVEAFEAIGRRERERERDGARSAEKRFGKASSFGGGKSVTWDD
FT                   DVSIAPSTTSSSSVVDARAGAQNPEAAARPHNTVFKPPVGGVKSFQ"
     MAQTSRSTDI KVTRAMRDAT NSVAPRDIAP KPPAEGKENS KYDGFFFADP AGLTTPAPAF        60
     PTKTMDPSPT SVLMGPGTPD EAAEQRPREK ATPENATDDG ADAEMTLATS PSDGESVDDD       120
     VASPESPERP ATVPDLAVAS TSPFVPNVLE ELLGAQLPRA ESNVRARRDA AGNLAANGAP       180
     QSAQTRRVQH ATSTPTSATS TRWRSVPSPA QIVSMGREWA ASGTVTPGRS TAIPTFLDDL       240
     VNNHVAKVAV DTKGTNTESN NTDEWDRTGD LKVECERLKR EVDFHREVSK EVGVSLDASA       300
     AELERTKRRV EFLEALKDEW DAQFKELSAE TERYRAEADA AREETLAAEA LAAAARAAAT       360
     SANAEAESLR KNVIHDDDGS TGEAPETSGT TSTSASATSA EVGSAALFRR HRSGAENDVA       420
     ASIAAALRER ESELDAARLN LDQTLAAAKA AEAKLAAKCE ECAALRGEVN VAKSTLAAAR       480
     EAVAQTEGAL MTTLEDKKRL VEDKKRLIKK IEMMETDADA KARDACERVR DATERGRRSV       540
     LRARANWGAV ALTTAALALG VCAWAAAVPP AGVLIAVPFG IDFRDWRLGS DGSTSAFNAG       600
     FNVRTVNFTL PGAGYAVAAE LSACRADLAT STALASALSS EASRFAGLAE ENDRLAAEVE       660
     DFARVTESLR EREADVRSLE SRLAHLEASA NDAATRGDDP FAASLAARAE TERLRHALAK       720
     ERSLRRRSAF LEKLDVVSIA AVCVAWGTCL LSAWFFARKE SGLRRTLNDY GALMEAASAE       780
     HERLGSELTR ATLDANEERT RRERSEGRAR ELERQLDASR KAANEATKRV EAFEAIGRRE       840
     RERERDGARS AEKRFGKASS FGGGKSVTWD DDVSIAPSTT SSSSVVDARA GAQNPEAAAR       900
     PHNTVFKPPV GGVKSFQ                                                      917
//

If you have problems or comments...

PBIL Back to PBIL home page