(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE1

PENCW_10.PE1         Location/Qualifiers
FT   CDS             join(1739..1792,1871..2392)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947665"
FT                   /orf_name="Pc13g00010"
FT                   /product="Putative uncharacterized protein Pc13g00010 "
FT                   /protein_id="CAP91070.1"
FT                   /db_xref="UniParc:UPI0001830C36"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G9"
FT                   /transl_table=1
FT                   /translation="MALGASVAIPGASTLAFKRPWSQRFQTHHLIIESYTTSSPSEKTK
FT                   CLHKEDQWHCRGPPRYKKKFTEVSRWGGSIIMVLTNIGSDRQHPTQRVEGIINSIYAEM
FT                   SRMQHNYILMLQNRDNMLRAYANDRRAYANENASLEEQNRSLLEHVKSLQRENCSLELK
FT                   HNQQMSEWAKERLQCPEKPDGKRPEGPV"
     MALGASVAIP GASTLAFKRP WSQRFQTHHL IIESYTTSSP SEKTKCLHKE DQWHCRGPPR        60
     YKKKFTEVSR WGGSIIMVLT NIGSDRQHPT QRVEGIINSI YAEMSRMQHN YILMLQNRDN       120
     MLRAYANDRR AYANENASLE EQNRSLLEHV KSLQRENCSL ELKHNQQMSE WAKERLQCPE       180
     KPDGKRPEGP V                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page