(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE10

PENCW_10.PE10        Location/Qualifiers
FT   CDS             25313..25708
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15947667"
FT                   /orf_name="Pc13g00100"
FT                   /product="Pc13g00100 protein"
FT                   /protein_id="CAP91079.1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI0001830CFC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5F9"
FT                   /transl_table=1
FT                   /translation="MMRSLFEGYRPTFKPHSLGYEAESLLLLTPSQQMCYYDGKLFGGY
FT                   IALLMDRILADCCKHKHKHKPAFTAYLITSFIHSVPPSAPMLLRAWPEKVEGRKVFLKG
FT                   SVRIPGKSAHDWVDAVRIGALFIRPKP"
     MMRSLFEGYR PTFKPHSLGY EAESLLLLTP SQQMCYYDGK LFGGYIALLM DRILADCCKH        60
     KHKHKPAFTA YLITSFIHSV PPSAPMLLRA WPEKVEGRKV FLKGSVRIPG KSAHDWVDAV       120
     RIGALFIRPK P                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page