(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE100

PENCW_10.PE100       Location/Qualifiers
FT   CDS             join(complement(240459..240590),complement(240205..240402),
FT                   complement(239760..239792),complement(239567..239697),
FT                   complement(239321..239474),complement(238624..239274),
FT                   complement(237791..238525))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128947"
FT                   /orf_name="Pc13g01000"
FT                   /product="Putative uncharacterized protein Pc13g01000 "
FT                   /function="hydrolase activity"
FT                   /protein_id="CAP91169.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniParc:UPI0001830437"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L3"
FT                   /transl_table=1
FT                   /translation="MSWFGNIFPCWGARKQGVHDLSAVPREMKPSRGSERNVKRSPWKD
FT                   RSSCYVNTVEGEAAENQHIGVEPDSMNFKADALSHTELDQGQVPSLSEIGRPFASIPKN
FT                   PALPPSQDPQAKLLYAVKIGPECLSEASRALIYKGATASYRWKGLNPISRSFFMFTLLV
FT                   AWDTGVDIWSASSEAQQRRNRSAEQRRRYRELEKQGGLGRGQTTMKCFPVMLEMPEEEM
FT                   KRDARTALYSIWTSSGPTVYSALKQMPMLEDMFLGLETEEKLILAFCDRAFRRADNLDI
FT                   ENSGFVRVSSVLASEFSSYATKRKTISSKLVSYYHPFLETVRKAADSLLSNQSGGELQL
FT                   TSASLSHMVDEIITIANDMNETGHVRDYYAPTDDIVDNRLKEIAREFIRQHKPRVESID
FT                   RDRIEQYTLRGVWKGEFLETAHAFVLRDWGLIFLFYTPLIRQPDTLRITWEQHELGELG
FT                   QNYASAIFQAPYPASYFDIKGHLSGYPANPAGAVASMLQSIPPDEVFINNVPAPRISQS
FT                   KDIVAINREPSSIRASLLVVSCFGLLLVRRSWGENQDELVIPSGEVFAGEKPSDGGKRV
FT                   LEEKTGLKGELSLIDFDKHTGTMDDRSWYQPNYRVKLNHEWSEIPLSDKDQNFEWVQDE
FT                   KDLESFPGQGKLKLAPEWREIAQKGLQLWKETYDPGIKRKSQ"
     MSWFGNIFPC WGARKQGVHD LSAVPREMKP SRGSERNVKR SPWKDRSSCY VNTVEGEAAE        60
     NQHIGVEPDS MNFKADALSH TELDQGQVPS LSEIGRPFAS IPKNPALPPS QDPQAKLLYA       120
     VKIGPECLSE ASRALIYKGA TASYRWKGLN PISRSFFMFT LLVAWDTGVD IWSASSEAQQ       180
     RRNRSAEQRR RYRELEKQGG LGRGQTTMKC FPVMLEMPEE EMKRDARTAL YSIWTSSGPT       240
     VYSALKQMPM LEDMFLGLET EEKLILAFCD RAFRRADNLD IENSGFVRVS SVLASEFSSY       300
     ATKRKTISSK LVSYYHPFLE TVRKAADSLL SNQSGGELQL TSASLSHMVD EIITIANDMN       360
     ETGHVRDYYA PTDDIVDNRL KEIAREFIRQ HKPRVESIDR DRIEQYTLRG VWKGEFLETA       420
     HAFVLRDWGL IFLFYTPLIR QPDTLRITWE QHELGELGQN YASAIFQAPY PASYFDIKGH       480
     LSGYPANPAG AVASMLQSIP PDEVFINNVP APRISQSKDI VAINREPSSI RASLLVVSCF       540
     GLLLVRRSWG ENQDELVIPS GEVFAGEKPS DGGKRVLEEK TGLKGELSLI DFDKHTGTMD       600
     DRSWYQPNYR VKLNHEWSEI PLSDKDQNFE WVQDEKDLES FPGQGKLKLA PEWREIAQKG       660
     LQLWKETYDP GIKRKSQ                                                      677
//

If you have problems or comments...

PBIL Back to PBIL home page