(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE101

PENCW_10.PE101       Location/Qualifiers
FT   CDS             join(complement(243017..243449),complement(242717..242967))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977829"
FT                   /orf_name="Pc13g01010"
FT                   /product="Putative uncharacterized protein Pc13g01010 "
FT                   /protein_id="CAP91170.1"
FT                   /db_xref="UniParc:UPI0001830438"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L4"
FT                   /transl_table=1
FT                   /translation="MALGIIRDKVISLKNHGLSIEDRKVLKEDRRLLFAWVDEAPNDRE
FT                   TPVTKWRKARSRKAYRTIQDASEQLFLAAILSITPTQCARKSFDRVLESLMRLNHEEFY
FT                   FTLGPETKSFLEAIAAEQGFAGNRQYLAFMKSLFPRIEPRQIQFAYSLVRRNDIPSFLG
FT                   KMLEGITSSQEWAKEESQGGNTTGCVTIIIPTNEHEDGSCNIRVNRTLLMQAIHDFRIT
FT                   SLKLE"
     MALGIIRDKV ISLKNHGLSI EDRKVLKEDR RLLFAWVDEA PNDRETPVTK WRKARSRKAY        60
     RTIQDASEQL FLAAILSITP TQCARKSFDR VLESLMRLNH EEFYFTLGPE TKSFLEAIAA       120
     EQGFAGNRQY LAFMKSLFPR IEPRQIQFAY SLVRRNDIPS FLGKMLEGIT SSQEWAKEES       180
     QGGNTTGCVT IIIPTNEHED GSCNIRVNRT LLMQAIHDFR ITSLKLE                     227
//

If you have problems or comments...

PBIL Back to PBIL home page