(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE102

PENCW_10.PE102       Location/Qualifiers
FT   CDS             244929..245282
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076576" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948725"
FT                   /orf_name="Pc13g01020"
FT                   /product="Pc13g01020 protein"
FT                   /protein_id="CAP91171.1"
FT                   /db_xref="UniParc:UPI0001830439"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L5"
FT                   /transl_table=1
FT                   /translation="MPSKTQKSLEALMAYIKQSKSRRTTILRGQGEPGHRAAPARGGNH
FT                   DARIGSRIDIGEIVKKTGKEYRRYKFQLNSNAEDSTLKRKAAQDSHKVYSTADVEIKES
FT                   RTQEEEEQAMRDF"
     MPSKTQKSLE ALMAYIKQSK SRRTTILRGQ GEPGHRAAPA RGGNHDARIG SRIDIGEIVK        60
     KTGKEYRRYK FQLNSNAEDS TLKRKAAQDS HKVYSTADVE IKESRTQEEE EQAMRDF          117
//

If you have problems or comments...

PBIL Back to PBIL home page