(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE103

PENCW_10.PE103       Location/Qualifiers
FT   CDS             join(246066..246090,246141..246436,246495..246873,
FT                   246953..247830)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185951" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948726"
FT                   /orf_name="Pc13g01030"
FT                   /product="Pc13g01030 protein"
FT                   /protein_id="CAP91172.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI000183043A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L6"
FT                   /transl_table=1
FT                   /translation="MDIASSQTDWNSNDEFFKFTRGRFIVNEAENLRKREIRFDLNSLA
FT                   RVAADSVGAGRCIAIKKYPDGMFNKAYLMCMDDGQEVIAKVPNPNAGVPHFTTASEVAT
FT                   MDFARKILDTPAPRVYTWNSQAKSHPVGAEFIIMDKIKGVPLSQVWSTMKLPQKLQVLL
FT                   AMTRLQKQWLSVTFSHYGSLYYTEDVRPPAGNHFVKDGKVVKDSEFAIGPATGRDWCDA
FT                   GRSNLDVEKGPFGAREVKATQSLEPPKPIALFCGPKLYRPDTEKKITALAWYRQVVGAL
FT                   IPKDTAITRSCLWHNDLHDDNVFVDPDNPAKITGIIDWQSCHISPLFNHNPDPAFLSWD
FT                   GLEPETLDLAPQPKLSGLSPEERSAAVHEYTLQNVFIGWRKLMHAKNPDLYRVVEFRRT
FT                   AAYGLIFLAHRMFEYGEAHFQSLLVDLKDTWTDLPAISSDTPFPFDFSEADFERIKLDS
FT                   NGAVAGTDLVAEVKERMGDLWPDKGFIEHERYDDCKAALHEVKGLILEQLAENDQEKAE
FT                   YERFWPFE"
     MDIASSQTDW NSNDEFFKFT RGRFIVNEAE NLRKREIRFD LNSLARVAAD SVGAGRCIAI        60
     KKYPDGMFNK AYLMCMDDGQ EVIAKVPNPN AGVPHFTTAS EVATMDFARK ILDTPAPRVY       120
     TWNSQAKSHP VGAEFIIMDK IKGVPLSQVW STMKLPQKLQ VLLAMTRLQK QWLSVTFSHY       180
     GSLYYTEDVR PPAGNHFVKD GKVVKDSEFA IGPATGRDWC DAGRSNLDVE KGPFGAREVK       240
     ATQSLEPPKP IALFCGPKLY RPDTEKKITA LAWYRQVVGA LIPKDTAITR SCLWHNDLHD       300
     DNVFVDPDNP AKITGIIDWQ SCHISPLFNH NPDPAFLSWD GLEPETLDLA PQPKLSGLSP       360
     EERSAAVHEY TLQNVFIGWR KLMHAKNPDL YRVVEFRRTA AYGLIFLAHR MFEYGEAHFQ       420
     SLLVDLKDTW TDLPAISSDT PFPFDFSEAD FERIKLDSNG AVAGTDLVAE VKERMGDLWP       480
     DKGFIEHERY DDCKAALHEV KGLILEQLAE NDQEKAEYER FWPFE                       525
//

If you have problems or comments...

PBIL Back to PBIL home page