(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE104

PENCW_10.PE104       Location/Qualifiers
FT   CDS             complement(247993..248463)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948727"
FT                   /orf_name="Pc13g01040"
FT                   /product="Pc13g01040 protein"
FT                   /protein_id="CAP91173.1"
FT                   /db_xref="UniParc:UPI000183043B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L7"
FT                   /transl_table=1
FT                   /translation="MASIFRLPSRISRQTFSWRSSFLRSVSPVREFSQSSFPLLDPTQK
FT                   FEEETLSGYSPDGFYPVKIGEVFQSRYQVVGKSWRHGSRGESCNIPFNGKDVIPTLPGI
FT                   RHGGFKGTPYMIQNFHEVFQDQPGPPRGLTEWLESWEAGQELEDVPDDDLQE"
     MASIFRLPSR ISRQTFSWRS SFLRSVSPVR EFSQSSFPLL DPTQKFEEET LSGYSPDGFY        60
     PVKIGEVFQS RYQVVGKSWR HGSRGESCNI PFNGKDVIPT LPGIRHGGFK GTPYMIQNFH       120
     EVFQDQPGPP RGLTEWLESW EAGQELEDVP DDDLQE                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page