(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE107

PENCW_10.PE107       Location/Qualifiers
FT   CDS             join(complement(252897..253019),complement(252793..252844),
FT                   complement(252644..252708),complement(252423..252599))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948729"
FT                   /orf_name="Pc13g01070"
FT                   /product="Putative uncharacterized protein Pc13g01070 "
FT                   /protein_id="CAP91176.1"
FT                   /db_xref="UniParc:UPI000183043E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N4"
FT                   /transl_table=1
FT                   /translation="MQDITEVPPGSKPYLSYQETPPKGIGLDNLVDDISHACLSQARQC
FT                   DISFGALSRGAGPSFPSWHLGISEISVLAPNAELKGLRSHRGPMASIMRAACRYLSPAD
FT                   KNLLADADLPLSIAEKDNMARHGYQIRRWRRSVS"
     MQDITEVPPG SKPYLSYQET PPKGIGLDNL VDDISHACLS QARQCDISFG ALSRGAGPSF        60
     PSWHLGISEI SVLAPNAELK GLRSHRGPMA SIMRAACRYL SPADKNLLAD ADLPLSIAEK       120
     DNMARHGYQI RRWRRSVS                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page