(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE109

PENCW_10.PE109       Location/Qualifiers
FT   CDS             join(255884..255979,256035..256323,256361..256399,
FT                   256530..256721,256783..257028,257482..257639)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948730"
FT                   /orf_name="Pc13g01090"
FT                   /product="Putative uncharacterized protein Pc13g01090 "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91178.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="UniParc:UPI000183043F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N5"
FT                   /transl_table=1
FT                   /translation="MAGDFGLQRQCQTCLAIFPTNDALRYHLEVYRLRERTLTLEIEKC
FT                   RAHAAPIYDPNKLCESCQVNAALTVASSNVSYQSDGEKDNGKDSISETTATLRSLGRRV
FT                   SKCPYYGCGKPFGSRKGLLKHFELPNRGFGTRRRLQRTIMKLDQMIETLESSSNDADLK
FT                   TPKRTLGETDLGQNSCPLRRVRARCKNGEALLDTTSEKAPQHVELQDKPFTSFELQPAY
FT                   EAVDMFAPLLFHDCPPPPTDNFDPPFFEASSSVGYRTQLGDGDPVGFCADITDPIPETE
FT                   FRFAWDENNFRPTTPQFHDQNMPARLLTPTSELKDVPWITVEFPVPGKTARRKKGLED"
     MAGDFGLQRQ CQTCLAIFPT NDALRYHLEV YRLRERTLTL EIEKCRAHAA PIYDPNKLCE        60
     SCQVNAALTV ASSNVSYQSD GEKDNGKDSI SETTATLRSL GRRVSKCPYY GCGKPFGSRK       120
     GLLKHFELPN RGFGTRRRLQ RTIMKLDQMI ETLESSSNDA DLKTPKRTLG ETDLGQNSCP       180
     LRRVRARCKN GEALLDTTSE KAPQHVELQD KPFTSFELQP AYEAVDMFAP LLFHDCPPPP       240
     TDNFDPPFFE ASSSVGYRTQ LGDGDPVGFC ADITDPIPET EFRFAWDENN FRPTTPQFHD       300
     QNMPARLLTP TSELKDVPWI TVEFPVPGKT ARRKKGLED                              339
//

If you have problems or comments...

PBIL Back to PBIL home page