(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE11

PENCW_10.PE11        Location/Qualifiers
FT   CDS             join(complement(28951..29113),complement(27558..27653),
FT                   complement(27279..27388))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128674"
FT                   /orf_name="Pc13g00110"
FT                   /product="Putative uncharacterized protein Pc13g00110 "
FT                   /protein_id="CAP91080.1"
FT                   /db_xref="UniParc:UPI0001830CFD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G0"
FT                   /transl_table=1
FT                   /translation="MATTGWDRGLFMLETELCAGSGNEATLDNGEKSTGLRKEVTRLSS
FT                   MPQIGQQSGACPMTGAFADPIRETCLAPSPGNAFAVLAETLSQSPVEIVHANSLEKAKL
FT                   ASLATKHAMPRDQSTDNG"
     MATTGWDRGL FMLETELCAG SGNEATLDNG EKSTGLRKEV TRLSSMPQIG QQSGACPMTG        60
     AFADPIRETC LAPSPGNAFA VLAETLSQSP VEIVHANSLE KAKLASLATK HAMPRDQSTD       120
     NG                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page