(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE110

PENCW_10.PE110       Location/Qualifiers
FT   CDS             join(complement(259844..260168),complement(259558..259783),
FT                   complement(259323..259344))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948731"
FT                   /orf_name="Pc13g01100"
FT                   /product="Putative uncharacterized protein Pc13g01100 "
FT                   /protein_id="CAP91179.1"
FT                   /db_xref="UniParc:UPI0001830440"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L8"
FT                   /transl_table=1
FT                   /translation="MPRLQLPSNRSPGLSLIFKDYAMNQMKGTFDSSTTPNNLRLSWLT
FT                   KALRYTQEEAEESLERLHISTIERLGSLDDMIMGGLVDQPLTEIDIKNETILMVSWHWD
FT                   KCCDGSCPYSNRVTPLIRKSKRSLSKRPCAPIFQRKRSHRRRNIAQRKAIMKEKRRCRR
FT                   LRSIRLTLYTGRLLARRYWFYYSNILP"
     MPRLQLPSNR SPGLSLIFKD YAMNQMKGTF DSSTTPNNLR LSWLTKALRY TQEEAEESLE        60
     RLHISTIERL GSLDDMIMGG LVDQPLTEID IKNETILMVS WHWDKCCDGS CPYSNRVTPL       120
     IRKSKRSLSK RPCAPIFQRK RSHRRRNIAQ RKAIMKEKRR CRRLRSIRLT LYTGRLLARR       180
     YWFYYSNILP                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page