(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE111

PENCW_10.PE111       Location/Qualifiers
FT   CDS             join(260191..260266,260355..260428,260513..260644,
FT                   260928..261041)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948732"
FT                   /orf_name="Pc13g01110"
FT                   /product="Putative uncharacterized protein Pc13g01110 "
FT                   /protein_id="CAP91180.1"
FT                   /db_xref="UniParc:UPI0001830441"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1L9"
FT                   /transl_table=1
FT                   /translation="MTAERRKLACICYVADDWRKLESTAVRTISFHRLGEMPCCEPIMS
FT                   GHGLPDQPLTRIFVPDPGRFGLKRKGSVTPIGYRLKHLARCCISDKGPQPVYVRPAILA
FT                   SPHIYGRDRASPMENTGIFDHRDASTY"
     MTAERRKLAC ICYVADDWRK LESTAVRTIS FHRLGEMPCC EPIMSGHGLP DQPLTRIFVP        60
     DPGRFGLKRK GSVTPIGYRL KHLARCCISD KGPQPVYVRP AILASPHIYG RDRASPMENT       120
     GIFDHRDAST Y                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page