(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE113

PENCW_10.PE113       Location/Qualifiers
FT   CDS             join(complement(265326..265400),complement(265081..265284),
FT                   complement(264516..265047),complement(264238..264463),
FT                   complement(263715..264172),complement(263108..263661))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000158769" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977830"
FT                   /orf_name="Pc13g01130"
FT                   /product="Pc13g01130 protein"
FT                   /protein_id="CAP91182.1"
FT                   /db_xref="InterPro:IPR005197"
FT                   /db_xref="UniParc:UPI00018304FB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M1"
FT                   /transl_table=1
FT                   /translation="MPMIKLRRSAARSSDHLEIKRGYLKKAEDLTRGELRELTTHDEYT
FT                   VYFGCHYFTIHDSPCTVYGESWHTPCQKTVDRPTGLCTLYGKYALNFLIGIVSNRNSTS
FT                   DYDDDMKRAKSLGIDAFALNIGTDPYTDQQLQLAYDSAADNDMKVFLSLDFNWWHIEQA
FT                   AEVGQKVAQYASKPAQLLVDDKVFVSSFAGDGMNVAEMRVAVGKSVFFAPNFHPSTGID
FT                   ITPVDGLLNWMAWPNNGNNKASTAEHSISVADGDKEYVDALGGKAYIAPVSPWFFTHFG
FT                   PEVSYSKNWNFPSDLLWFNRWNEILELKPRFIEIVTWNDYGESHYIGPLSSPHTDDGAS
FT                   KWVNDMPHEGWLDISKPYIAAFKAGQSSPDSHISSDELVYWYRPAPRGVNCDSTDTCMV
FT                   PANNDSGNYFMGRPDGWESMADSVFIVSLLTAPATVQVNSGGTVHNYEAPAGASAKEVP
FT                   MGVGAQSFEVNRDGETILSGTSLKEVIDGCVCGLYNFNAYVGTLPPGSNDVLQPEGLSA
FT                   FTQGLRVQTCQPTPSLGTVPPPAPSLSKSTILPSSPPGVTKAPEPCSAILSTVVTVTVT
FT                   EAMAPPNSPPTRTCGGGGGEGGGGRNRACIAGTGANNYSGLCSFCCSYGYCPSGPCTCT
FT                   NYGTPIPLPPSTGARGAPLIGEDDSYLGLCSFACDHGYCPPTACRIA"
     MPMIKLRRSA ARSSDHLEIK RGYLKKAEDL TRGELRELTT HDEYTVYFGC HYFTIHDSPC        60
     TVYGESWHTP CQKTVDRPTG LCTLYGKYAL NFLIGIVSNR NSTSDYDDDM KRAKSLGIDA       120
     FALNIGTDPY TDQQLQLAYD SAADNDMKVF LSLDFNWWHI EQAAEVGQKV AQYASKPAQL       180
     LVDDKVFVSS FAGDGMNVAE MRVAVGKSVF FAPNFHPSTG IDITPVDGLL NWMAWPNNGN       240
     NKASTAEHSI SVADGDKEYV DALGGKAYIA PVSPWFFTHF GPEVSYSKNW NFPSDLLWFN       300
     RWNEILELKP RFIEIVTWND YGESHYIGPL SSPHTDDGAS KWVNDMPHEG WLDISKPYIA       360
     AFKAGQSSPD SHISSDELVY WYRPAPRGVN CDSTDTCMVP ANNDSGNYFM GRPDGWESMA       420
     DSVFIVSLLT APATVQVNSG GTVHNYEAPA GASAKEVPMG VGAQSFEVNR DGETILSGTS       480
     LKEVIDGCVC GLYNFNAYVG TLPPGSNDVL QPEGLSAFTQ GLRVQTCQPT PSLGTVPPPA       540
     PSLSKSTILP SSPPGVTKAP EPCSAILSTV VTVTVTEAMA PPNSPPTRTC GGGGGEGGGG       600
     RNRACIAGTG ANNYSGLCSF CCSYGYCPSG PCTCTNYGTP IPLPPSTGAR GAPLIGEDDS       660
     YLGLCSFACD HGYCPPTACR IA                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page