(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE114

PENCW_10.PE114       Location/Qualifiers
FT   CDS             join(complement(266620..266739),complement(266287..266487))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824603"
FT                   /orf_name="Pc13g01140"
FT                   /product="Putative uncharacterized protein Pc13g01140 "
FT                   /protein_id="CAP91183.1"
FT                   /db_xref="UniParc:UPI00018304FC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M2"
FT                   /transl_table=1
FT                   /translation="MTSVGKTIANVSHERNRVREQEAKPSGSFIPTPKRAIQEQGPDHD
FT                   YDFGTAHKAKTVLPVFVLRQHGKRPDWVLIRWPQGDEPLGAQLADLHNALPRPNAPIRK
FT                   EI"
     MTSVGKTIAN VSHERNRVRE QEAKPSGSFI PTPKRAIQEQ GPDHDYDFGT AHKAKTVLPV        60
     FVLRQHGKRP DWVLIRWPQG DEPLGAQLAD LHNALPRPNA PIRKEI                      106
//

If you have problems or comments...

PBIL Back to PBIL home page