(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE115

PENCW_10.PE115       Location/Qualifiers
FT   CDS             join(266741..267477,267712..267882,267933..268036,
FT                   268088..268113)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128948"
FT                   /orf_name="Pc13g01150"
FT                   /product="Putative uncharacterized protein Pc13g01150 "
FT                   /protein_id="CAP91184.1"
FT                   /db_xref="UniParc:UPI00018304FD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M3"
FT                   /transl_table=1
FT                   /translation="MAPQIPEEDHCGHYFETFTQEITSDCGCLETPRENVKGNASCIIS
FT                   KFKFAQTPTCLSLGLIMIGIVGARLFVNCMSQDESHYHHLEGENGGLEDAVTVIENIFA
FT                   ADRQSMEECGLQPGEFKILDKAIISQYSDKDEQILRAETVVYCHIEKVSEKFNNSPNAI
FT                   IEKLFASGWVELEKVDSPLESRCELNREKLGMPETRIASIYKAFILVKCLVEGKHLYYT
FT                   GGSRADSRFANPQAFGVKPALGFSPSLMYLDKEEKRDPYIQSSGLYCDKSLDFGERVST
FT                   PDDFKSFVKWATVPRSKTVVETWNKRESKYKIVEPIDTSDELDDDAGYVFVARKRVDRA
FT                   PSERR"
     MAPQIPEEDH CGHYFETFTQ EITSDCGCLE TPRENVKGNA SCIISKFKFA QTPTCLSLGL        60
     IMIGIVGARL FVNCMSQDES HYHHLEGENG GLEDAVTVIE NIFAADRQSM EECGLQPGEF       120
     KILDKAIISQ YSDKDEQILR AETVVYCHIE KVSEKFNNSP NAIIEKLFAS GWVELEKVDS       180
     PLESRCELNR EKLGMPETRI ASIYKAFILV KCLVEGKHLY YTGGSRADSR FANPQAFGVK       240
     PALGFSPSLM YLDKEEKRDP YIQSSGLYCD KSLDFGERVS TPDDFKSFVK WATVPRSKTV       300
     VETWNKRESK YKIVEPIDTS DELDDDAGYV FVARKRVDRA PSERR                       345
//

If you have problems or comments...

PBIL Back to PBIL home page