(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE116

PENCW_10.PE116       Location/Qualifiers
FT   CDS             join(270126..270150,270180..271450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948733"
FT                   /orf_name="Pc13g01160"
FT                   /product="Pc13g01160 protein"
FT                   /protein_id="CAP91185.1"
FT                   /db_xref="UniParc:UPI00018304FE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M4"
FT                   /transl_table=1
FT                   /translation="MKRVVRKIVKILSSRRFHVTYHLLCRWQTGLEFFLYQLCKTTAPG
FT                   LIDDCHWSCAEAAELTRLSEKVTEFFCFHHKPIFKDCGISEQERESFCSDLQEIRQIRH
FT                   CAVHRVDINAATINKYAKCALHVLGTIKRLGGQGFRKDHGEAVCPVPFPSHYNNRSPRH
FT                   ELQLDRFVNSFWETERHLILQASSHISPSQHEEQNPGHNSKKAEGARLREAQQDDAQPT
FT                   KAKEAEHSQKHHDDAQPTKAKKAEHSQKQQDDAQLKKAKKAEHSQQQQDDAQLKKAKKT
FT                   EHSQKQQDDAQLKKAKKAEHSQQQQDDAQPTKAKEAEHSQKHHDDAQPTKAKKAEHSQQ
FT                   QQDDAQLKKAKKAEHSQKQQDDAQLKKAKKAEHNQQQQDDAQLKKAKKAEHSQKQQGDA
FT                   RPKKYMRTVNIQKICASSNMCKGKSTICTHTT"
     MKRVVRKIVK ILSSRRFHVT YHLLCRWQTG LEFFLYQLCK TTAPGLIDDC HWSCAEAAEL        60
     TRLSEKVTEF FCFHHKPIFK DCGISEQERE SFCSDLQEIR QIRHCAVHRV DINAATINKY       120
     AKCALHVLGT IKRLGGQGFR KDHGEAVCPV PFPSHYNNRS PRHELQLDRF VNSFWETERH       180
     LILQASSHIS PSQHEEQNPG HNSKKAEGAR LREAQQDDAQ PTKAKEAEHS QKHHDDAQPT       240
     KAKKAEHSQK QQDDAQLKKA KKAEHSQQQQ DDAQLKKAKK TEHSQKQQDD AQLKKAKKAE       300
     HSQQQQDDAQ PTKAKEAEHS QKHHDDAQPT KAKKAEHSQQ QQDDAQLKKA KKAEHSQKQQ       360
     DDAQLKKAKK AEHNQQQQDD AQLKKAKKAE HSQKQQGDAR PKKYMRTVNI QKICASSNMC       420
     KGKSTICTHT T                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page