(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE117

PENCW_10.PE117       Location/Qualifiers
FT   CDS             join(complement(273155..273482),complement(272976..273100))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076562" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948734"
FT                   /orf_name="Pc13g01170"
FT                   /product="Putative uncharacterized protein Pc13g01170 "
FT                   /protein_id="CAP91186.1"
FT                   /db_xref="UniParc:UPI00018304FF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M5"
FT                   /transl_table=1
FT                   /translation="MSWKERSRAYLRQFGVKRTGEALRCKRNYLLREYRSMQESLSETT
FT                   SSGAVPLRAQRDEARMSCLPSLPIYAPRGSRTKTRILIHALEQLAVSERRHLTNDSDNA
FT                   NERLPGYTIQPPHTLRPAPSRHISYHWKFVHRMAAATRASRNAEIL"
     MSWKERSRAY LRQFGVKRTG EALRCKRNYL LREYRSMQES LSETTSSGAV PLRAQRDEAR        60
     MSCLPSLPIY APRGSRTKTR ILIHALEQLA VSERRHLTND SDNANERLPG YTIQPPHTLR       120
     PAPSRHISYH WKFVHRMAAA TRASRNAEIL                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page