(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE119

PENCW_10.PE119       Location/Qualifiers
FT   CDS             join(complement(276753..276851),complement(276595..276690),
FT                   complement(276433..276515),complement(275920..276064),
FT                   complement(275486..275533),complement(275222..275383))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18977831"
FT                   /orf_name="Pc13g01190"
FT                   /product="Putative uncharacterized protein Pc13g01190 "
FT                   /protein_id="CAP91188.1"
FT                   /db_xref="UniParc:UPI0001830501"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M7"
FT                   /transl_table=1
FT                   /translation="MAGCWRACVESSRLRDATRWDYGHLLRDNDMNMYVPARYRTIDAI
FT                   LAVGFRGTLRNPNQGPIRSMPGDLHATVVQTGLNTAVFIRPGSLQFPGAVSKRNGDYNI
FT                   DCANGFGIQPLPSAETSARMAMANFDANADPLANADRGTVDMPRKAGQFDSIRRSTTVL
FT                   SPTHGDKSLSWYVTNCGSGAELDRRRHVTSVTARRRPKDYFTWKQSS"
     MAGCWRACVE SSRLRDATRW DYGHLLRDND MNMYVPARYR TIDAILAVGF RGTLRNPNQG        60
     PIRSMPGDLH ATVVQTGLNT AVFIRPGSLQ FPGAVSKRNG DYNIDCANGF GIQPLPSAET       120
     SARMAMANFD ANADPLANAD RGTVDMPRKA GQFDSIRRST TVLSPTHGDK SLSWYVTNCG       180
     SGAELDRRRH VTSVTARRRP KDYFTWKQSS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page