(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE12

PENCW_10.PE12        Location/Qualifiers
FT   CDS             join(29153..29324,29378..29922)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128675"
FT                   /orf_name="Pc13g00120"
FT                   /product="Putative uncharacterized protein Pc13g00120 "
FT                   /protein_id="CAP91081.1"
FT                   /db_xref="UniParc:UPI0001830CFE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5G1"
FT                   /transl_table=1
FT                   /translation="MRSFNYLLLIGNVVAGSYLAIIEDNDGENNCRVWSQNNHGCTGYS
FT                   ATFAKLKGKDCSGFIGAGSDDKSVKVDICGTENGEQVAWVTVNKNGTVSFLNRQGDTSS
FT                   CMLENGLKVPSGCSIGNTGSSQTTTPISTASQSSFSTAIGTSTSGTARVDQSPTPTSTS
FT                   TPTDSPSFISDGKSATETPRADQSPTPIFTSTPTDSPSLDLISAGKSATGISLADHSPT
FT                   LTSTPACKCSCESAAV"
     MRSFNYLLLI GNVVAGSYLA IIEDNDGENN CRVWSQNNHG CTGYSATFAK LKGKDCSGFI        60
     GAGSDDKSVK VDICGTENGE QVAWVTVNKN GTVSFLNRQG DTSSCMLENG LKVPSGCSIG       120
     NTGSSQTTTP ISTASQSSFS TAIGTSTSGT ARVDQSPTPT STSTPTDSPS FISDGKSATE       180
     TPRADQSPTP IFTSTPTDSP SLDLISAGKS ATGISLADHS PTLTSTPACK CSCESAAV         238
//

If you have problems or comments...

PBIL Back to PBIL home page