(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE121

PENCW_10.PE121       Location/Qualifiers
FT   CDS             join(281390..281521,281569..281826)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948737"
FT                   /orf_name="Pc13g01210"
FT                   /product="Pc13g01210 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91190.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001830503"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1M9"
FT                   /transl_table=1
FT                   /translation="MTENTPLWAIEEGSSSQSQIPRPPVEKRRNVSLACIECRQKRIKC
FT                   SGTTPCANCTAKGCQCFYGSDRRRKAHSIESSMLHQALLYTVVKLRSGNPDTVRSFVLQ
FT                   IRALQSARDGTSFLLSESRQDDQAV"
     MTENTPLWAI EEGSSSQSQI PRPPVEKRRN VSLACIECRQ KRIKCSGTTP CANCTAKGCQ        60
     CFYGSDRRRK AHSIESSMLH QALLYTVVKL RSGNPDTVRS FVLQIRALQS ARDGTSFLLS       120
     ESRQDDQAV                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page