(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE122

PENCW_10.PE122       Location/Qualifiers
FT   CDS             join(282432..283111,283167..284121)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948738"
FT                   /orf_name="Pc13g01220"
FT                   /product="Pc13g01220 protein"
FT                   /protein_id="CAP91191.1"
FT                   /db_xref="UniParc:UPI0001830504"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N0"
FT                   /transl_table=1
FT                   /translation="MSPSTQSPSNASQCVAPSSVDSDGLKKFLKLVSMLASSPESQTMS
FT                   AILGEIAYQREQVHARDKELKKAQDQVLDLEERKRVTIEEMFAANEGEKAKQKDALDRV
FT                   ESLRASVNQKDKRLAEYSKEVQGLRQQVDSIKSSYSLELDKVSQSAKDISTLQQNLEEK
FT                   DKTIDRMKAAGSSLKSMFSSAQKKIEELEAEKACLDQALQASQGQLQTLQSFTVQQLEL
FT                   DENSIMASFSDLWVFASSEVFAILREDLDEEVLKVCLCLNPNPLYNHIHSSFDQKDKSI
FT                   WDKLRKENTKIAENNIPLVPSNSLEAKGMRLAMTMAFLSRELCKYIFQPNYLFPDDSEI
FT                   RGVLSHLAENNTEKESFCRRVLLSIDHSAEEKIRQTRIQTVIRNVSSYLWALLSQTQHD
FT                   SIRISIEKIVQKAAGFWLPIQRAQQRYETEFELADFEIADCEPFHFPGDSALPDRQDQG
FT                   ARDMNVLTVFPCITLVKDGDRDPLTHLIQLRSSQKLFVAAEHEASQMTTSFVVPRRSST
FT                   RSRRKSIAHNTDRPNGASFLGGKSPQP"
     MSPSTQSPSN ASQCVAPSSV DSDGLKKFLK LVSMLASSPE SQTMSAILGE IAYQREQVHA        60
     RDKELKKAQD QVLDLEERKR VTIEEMFAAN EGEKAKQKDA LDRVESLRAS VNQKDKRLAE       120
     YSKEVQGLRQ QVDSIKSSYS LELDKVSQSA KDISTLQQNL EEKDKTIDRM KAAGSSLKSM       180
     FSSAQKKIEE LEAEKACLDQ ALQASQGQLQ TLQSFTVQQL ELDENSIMAS FSDLWVFASS       240
     EVFAILREDL DEEVLKVCLC LNPNPLYNHI HSSFDQKDKS IWDKLRKENT KIAENNIPLV       300
     PSNSLEAKGM RLAMTMAFLS RELCKYIFQP NYLFPDDSEI RGVLSHLAEN NTEKESFCRR       360
     VLLSIDHSAE EKIRQTRIQT VIRNVSSYLW ALLSQTQHDS IRISIEKIVQ KAAGFWLPIQ       420
     RAQQRYETEF ELADFEIADC EPFHFPGDSA LPDRQDQGAR DMNVLTVFPC ITLVKDGDRD       480
     PLTHLIQLRS SQKLFVAAEH EASQMTTSFV VPRRSSTRSR RKSIAHNTDR PNGASFLGGK       540
     SPQP                                                                    544
//

If you have problems or comments...

PBIL Back to PBIL home page