(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE123

PENCW_10.PE123       Location/Qualifiers
FT   CDS             join(285772..285774,285991..286290,286337..286798)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948739"
FT                   /orf_name="Pc13g01230"
FT                   /product="Putative uncharacterized protein Pc13g01230 "
FT                   /protein_id="CAP91192.1"
FT                   /db_xref="UniParc:UPI0001830505"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N1"
FT                   /transl_table=1
FT                   /translation="MRVSKSFNSAFSSSVFGLGSGYSCFRRFLDHPGAFRRVLRCGAVV
FT                   TGPLVFQYFAKQYVDDVEIDILVSYDQSHTVTQHLQQSEGYEMVDEECSPFTETLKVSR
FT                   FKKERKTVRVSAIRNLTPLAFFLTHERTTACFNFLTEDYGYCLFPMSMRRKLDYRVCPV
FT                   LEEIEYGWLPEPQDGWTFYADFPHDGVTVSDHYAMVPVDMEIRTDRWIGDRFTWKVKLF
FT                   TDSPAEGVEKREYAFFVKSQSVHLGSWNETEQ"
     MRVSKSFNSA FSSSVFGLGS GYSCFRRFLD HPGAFRRVLR CGAVVTGPLV FQYFAKQYVD        60
     DVEIDILVSY DQSHTVTQHL QQSEGYEMVD EECSPFTETL KVSRFKKERK TVRVSAIRNL       120
     TPLAFFLTHE RTTACFNFLT EDYGYCLFPM SMRRKLDYRV CPVLEEIEYG WLPEPQDGWT       180
     FYADFPHDGV TVSDHYAMVP VDMEIRTDRW IGDRFTWKVK LFTDSPAEGV EKREYAFFVK       240
     SQSVHLGSWN ETEQ                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page