(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE124

PENCW_10.PE124       Location/Qualifiers
FT   CDS             join(complement(287421..287570),complement(287100..287316),
FT                   complement(286905..286993))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128949"
FT                   /orf_name="Pc13g01240"
FT                   /product="Putative uncharacterized protein Pc13g01240 "
FT                   /protein_id="CAP91193.1"
FT                   /db_xref="UniParc:UPI0001830506"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N6"
FT                   /transl_table=1
FT                   /translation="MDLPWFYCADRCSDEEGTRGQSENEQTKERISGGGRSIKFLDPEY
FT                   SAESMVSPEDRTRIPTLIRFRLDAKSLKDQDLWNQGMQRKYIEMIGTIEALSKEAAALR
FT                   KQVEVLPSGDAVKTRETVGLISHGAPGYSNNDKRTPPTGKFKVHVNV"
     MDLPWFYCAD RCSDEEGTRG QSENEQTKER ISGGGRSIKF LDPEYSAESM VSPEDRTRIP        60
     TLIRFRLDAK SLKDQDLWNQ GMQRKYIEMI GTIEALSKEA AALRKQVEVL PSGDAVKTRE       120
     TVGLISHGAP GYSNNDKRTP PTGKFKVHVN V                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page