(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE127

PENCW_10.PE127       Location/Qualifiers
FT   CDS             join(291831..292588,292691..292769)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948742"
FT                   /orf_name="Pc13g01270"
FT                   /product="Pc13g01270 protein"
FT                   /protein_id="CAP91196.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830509"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1N9"
FT                   /transl_table=1
FT                   /translation="MSVQLDNHQSIINYCRSCPEDQLTGGLRSGNQVVKLPDCDLVVKF
FT                   GPFVSSYEAKNQQKAYGIINPDIVIVPSVHKFFVDDEGWGYIISDFIQGKIIEPLSDSH
FT                   IHRLAHILEYFRSITANRAGSLCGGPSVGLLFPDTNDLTISNVQQVEEWFNSRLFPGDG
FT                   KVHFDPTPLVLCHLDIAPRNVIWLDDGRVCLLDWASAGFYPRLLEFASLFFQEYRFSEM
FT                   LLKAVGFDYGRDKEEQQRICQALYNNERYSFWLHLSSSITSGTAKTSDLTRRKWYW"
     MSVQLDNHQS IINYCRSCPE DQLTGGLRSG NQVVKLPDCD LVVKFGPFVS SYEAKNQQKA        60
     YGIINPDIVI VPSVHKFFVD DEGWGYIISD FIQGKIIEPL SDSHIHRLAH ILEYFRSITA       120
     NRAGSLCGGP SVGLLFPDTN DLTISNVQQV EEWFNSRLFP GDGKVHFDPT PLVLCHLDIA       180
     PRNVIWLDDG RVCLLDWASA GFYPRLLEFA SLFFQEYRFS EMLLKAVGFD YGRDKEEQQR       240
     ICQALYNNER YSFWLHLSSS ITSGTAKTSD LTRRKWYW                               278
//

If you have problems or comments...

PBIL Back to PBIL home page