(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE128

PENCW_10.PE128       Location/Qualifiers
FT   CDS             complement(295236..296234)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200308" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948743"
FT                   /orf_name="Pc13g01280"
FT                   /product="Pc13g01280 protein"
FT                   /protein_id="CAP91197.1"
FT                   /db_xref="UniParc:UPI000183050A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P0"
FT                   /transl_table=1
FT                   /translation="MERIASGFGRYLPIAEANNLIRTALLNVPFTQDVQVAGIGTTKTG
FT                   YVIRFKDTASAEAARENNEWLRELGNETELVKPRFGAVVHHVPTEDWTSSETKKELFKR
FT                   SWKRTTSRNGGFRIEYIGSYARLPLAEALKTMSLERLQELEMIDPTPLPPWRTEAFSAI
FT                   EIEPDRETAIEQAKAAGSKSDVILYSDASGHNGHLGAAAIGFNKNSPEATESLQIQVGP
FT                   MDRWAVHAAEPLGVLQAITLINNIALKHRRSMDTRVKSATTLSDSMSDLQAIQNPGNKS
FT                   GQQIIHTILRAVTNTKTHGIAVRLQWVPVLYISRICTYIVSHFLKTNLEPR"
     MERIASGFGR YLPIAEANNL IRTALLNVPF TQDVQVAGIG TTKTGYVIRF KDTASAEAAR        60
     ENNEWLRELG NETELVKPRF GAVVHHVPTE DWTSSETKKE LFKRSWKRTT SRNGGFRIEY       120
     IGSYARLPLA EALKTMSLER LQELEMIDPT PLPPWRTEAF SAIEIEPDRE TAIEQAKAAG       180
     SKSDVILYSD ASGHNGHLGA AAIGFNKNSP EATESLQIQV GPMDRWAVHA AEPLGVLQAI       240
     TLINNIALKH RRSMDTRVKS ATTLSDSMSD LQAIQNPGNK SGQQIIHTIL RAVTNTKTHG       300
     IAVRLQWVPV LYISRICTYI VSHFLKTNLE PR                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page