(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE130

PENCW_10.PE130       Location/Qualifiers
FT   CDS             complement(<300926..>301906)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000136556" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824604"
FT                   /orf_name="Pc13g01300"
FT                   /product="Pc13g01300 protein"
FT                   /protein_id="CAP91199.1"
FT                   /db_xref="UniParc:UPI000183050B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P5"
FT                   /transl_table=1
FT                   /translation="PAGAPEPLPTNTQESTSSFSIEDFQPRVTASSLGSLPDSRKRTRS
FT                   GDAFTPSESTGRATTREVWRLIDSLKTIIHHQTTLIESTEAELQEVKHDQNVLRDQNEN
FT                   LHEEVRALRTQIEILPQAAPTRSWATVAASGGVRPPQLTHQRPDKDQNCVRISTQRLLV
FT                   DPTDNHNGDRNTFGRYLPTDSANTHIRMALLSAPSTQYAEVAGIGTTKTGYVIRFKNPT
FT                   SAEAARNNTDWLNELGNSTKLVKPRFGVVVHRTPTEDFDLQNASQQAIEKIMDEDELTE
FT                   RGFRIEEVAWLKKKDKELGKFASLGIWFDSAEGAEWLLVNGLLVGQ"
     PAGAPEPLPT NTQESTSSFS IEDFQPRVTA SSLGSLPDSR KRTRSGDAFT PSESTGRATT        60
     REVWRLIDSL KTIIHHQTTL IESTEAELQE VKHDQNVLRD QNENLHEEVR ALRTQIEILP       120
     QAAPTRSWAT VAASGGVRPP QLTHQRPDKD QNCVRISTQR LLVDPTDNHN GDRNTFGRYL       180
     PTDSANTHIR MALLSAPSTQ YAEVAGIGTT KTGYVIRFKN PTSAEAARNN TDWLNELGNS       240
     TKLVKPRFGV VVHRTPTEDF DLQNASQQAI EKIMDEDELT ERGFRIEEVA WLKKKDKELG       300
     KFASLGIWFD SAEGAEWLLV NGLLVGQ                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page