(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE131

PENCW_10.PE131       Location/Qualifiers
FT   CDS             complement(304368..305837)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948744"
FT                   /orf_name="Pc13g01310"
FT                   /product="Pc13g01310 protein"
FT                   /protein_id="CAP91200.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000183050C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P6"
FT                   /transl_table=1
FT                   /translation="MPLLGLPLEILLWVGKFTDEKGLRTLCLTSREFNVIFRKSLFDCI
FT                   DFQDSPPIHWAIEHRSLGILQHSLGWEKADINEMYSGFTPLMLATQLRYADAVDLLLSH
FT                   HSVKVIQCNTLGESAFSIAVLHGSVKIVERLLNVQNVDLNNQSLDGIAPISVALTCRQT
FT                   YVFQLLLSDERTNVNICDHHGQTPLHLATEIGDYGAIQMLVRNPRVDVNCFNHRQETPL
FT                   LLAVKGHGRFLPIHKRLLIIEALLLSPCLNLNYQDENGRTAIWYAVSNSDLKLVELLLQ
FT                   QTNLDLNCADKLGQTPLAKAAANGSLDLIKVLFRQPGLHKSPSPQFTDAFPPLWSACRA
FT                   GQFAAVEFLLQNSADINQISPSGTSPLEVAIIMEHVDIVHLLVSSEKSLLINDQNHCSS
FT                   FTALMFASALGKVEIVKILLEHPNINVNAVDDQGRTSFWWAAAGGHYEVVQLLANRRGV
FT                   KKRLKDSNGQTAYAIAEQRKHGHVMVYLRSL"
     MPLLGLPLEI LLWVGKFTDE KGLRTLCLTS REFNVIFRKS LFDCIDFQDS PPIHWAIEHR        60
     SLGILQHSLG WEKADINEMY SGFTPLMLAT QLRYADAVDL LLSHHSVKVI QCNTLGESAF       120
     SIAVLHGSVK IVERLLNVQN VDLNNQSLDG IAPISVALTC RQTYVFQLLL SDERTNVNIC       180
     DHHGQTPLHL ATEIGDYGAI QMLVRNPRVD VNCFNHRQET PLLLAVKGHG RFLPIHKRLL       240
     IIEALLLSPC LNLNYQDENG RTAIWYAVSN SDLKLVELLL QQTNLDLNCA DKLGQTPLAK       300
     AAANGSLDLI KVLFRQPGLH KSPSPQFTDA FPPLWSACRA GQFAAVEFLL QNSADINQIS       360
     PSGTSPLEVA IIMEHVDIVH LLVSSEKSLL INDQNHCSSF TALMFASALG KVEIVKILLE       420
     HPNINVNAVD DQGRTSFWWA AAGGHYEVVQ LLANRRGVKK RLKDSNGQTA YAIAEQRKHG       480
     HVMVYLRSL                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page