(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE133

PENCW_10.PE133       Location/Qualifiers
FT   CDS             join(309937..310111,310204..310327,310479..310554)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671901"
FT                   /orf_name="Pc13g01330"
FT                   /product="Putative uncharacterized protein Pc13g01330 "
FT                   /protein_id="CAP91202.1"
FT                   /db_xref="UniParc:UPI000183050E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1P8"
FT                   /transl_table=1
FT                   /translation="MEMRPPTLSVQLLSPLLWPIKLVQSRCGSTEGSDPRNNSMVLTMW
FT                   RGGGLLVRNHTDTVYDGPGIEPAPDIENWDNKRIYVRVIEWTAGQSLRVEGKSGCADIV
FT                   GAFERTMMQVEIKQADQSEH"
     MEMRPPTLSV QLLSPLLWPI KLVQSRCGST EGSDPRNNSM VLTMWRGGGL LVRNHTDTVY        60
     DGPGIEPAPD IENWDNKRIY VRVIEWTAGQ SLRVEGKSGC ADIVGAFERT MMQVEIKQAD       120
     QSEH                                                                    124
//

If you have problems or comments...

PBIL Back to PBIL home page